PRGDB00067033 (At.71105)

From PRG Wiki
Jump to: navigation, search
At.71105
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337466 (NM_105948)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G72900) mRNA, complete cds

DNA Sequence

GAGTATCAGAAATaaaaaaaaaTGTCTTCTGCTACTGCGACTTATAACTACGATGTTTTTCTGAGTTTCAGAGGACCCGACACTCGCCGCAAGTTCATCAGCTTTCTCTACAAAGAACTTGTTGGAAGGGACATTCGAACCTTTAAAGACGACAAAGAGCTAGAGAATGGCCAGATGATTTCTCCGGAGCTCATACTCGCCATCGAGGATTCGAGATTTGCCGTCGTTGTTGTCTCCGTGAACTACGCTGCGTCTTCTTGGTGTCTCGATGAGCTCGTAAAGATCATGGATATCCAGAAGAACAAGGGTTCCATCACCGTGATGCCTATCTTCTACGGCGTGAATCCGTGTCATTTGAGGAGGCAAATCGGAGATGTCGCTGAACAGTTTAAGAAGCACGAGGCAAGAGAAAAAGATCTTGAGAAAGTGCTTAAATGGAGGCAAGCGTTGGCCGCTTTGGCAGATATCTCCGGCGATTGTTCAGGGGAAGATGACTCGAAGCTGGTGGACGTAATCGCTGACAAGATATCAAAAGAGCTGATGATAGTTACAAGAATAAGCAATGGGAGGAACCTAGTTGGGATTGATAAACACATGAACGAACTTAACCGATTGATGGATTTGAATTCCAACAAAGGTAAGAGAATGGTTGGGATTTGGGCAAGAGGAGGAAGTTGTAGATCGGCTCTAGCTAAATATGTTTATCAGACATCCTGTCAACACTTTGATAGCCATTGTTTTCTTGGAAACGTGAAACGGATTTGTCAGGGTAACTACTTTGAAAGCCATCTACACAAAGAGTTTCTGGATAATATTCAAGGAGAAAACTCTAGCAAACAAAGTCTCAAGAAGCAAAAGGTTCTGCTTGTGGCAGACGACGTCGATAAGCTTGAACAGTTAGATGCTCTTGCAGGGGATTTCAGCGGTTTTGGTCCGGGGAGTGTTGTTATCATCACTACAAAAGATAAGCAGTTGTTGATTTCTTATGGTATACAGCTTGTCTACGAAGCTGAGTTTTTGACATTCCAGAAATTTTGTCGTAGCTTCCGATCATTGGCCTTTAAAAAGAGAGACGACATTTCTGCTGCGTTCGAGTGGGCTTTGTATATATAAAGCAATGAATTTTGCCACGGAATGTTTTAGCTCTCAAAGTAGAAGATCTGGTTATGAGAAAGTGTTGGAATCAGTTTAATAAGTTAGATCCCTTGAGTCATATGCATTAAGTTAACTAAACTTAATAAGTTGTGTGGCTTTCAAATAAGGTTGTTTTGTCTATTTTTGGAGTGGGTTCTCTTGGGGTGTATAAAAATGTCACTCTTCATTGGATTAAATAATATACAAAttttttttGTTATAATCAAAT


Protein sequences

Name Description Sequence
At.71105 translated coding region predicted by ESTScan from UniGene At.71105

MSSATATYNYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADISGDCSGEDDSKLVDVIADKISKELMIVTRISNGRNLVGIDKHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKYVYQTSCQHFDSHCFLGNVKRICQGNYFESHLHKEFLDNIQGENSSKQSLKKQKVLLVADDVDKLEQLDALAGDFSGFGPGSVVIITTKDKQLLISYGIQLVYEAEFLTFQKFCRSFRSLAFKKRDDISAAFEWALYI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-151 TIR
Toll-Interleukin receptor

SSATATYNYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADISG

Gene3D: G3DSA:3.40.50.10140
7-138 G3DSA:3.40.50.10140

TYNYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLK

ProfileScan: PS50104
IPR000157
8-149 TIR
Toll-Interleukin receptor

YNYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADI

HMMSmart: SM00255
IPR000157
9-149 TIR
Toll-Interleukin receptor

NYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADI

HMMPfam: PF01582
IPR000157
12-144 TIR
Toll-Interleukin receptor

VFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALA

HMMPanther: PTHR23155
21-297 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADISGDCSGEDDSKLVDVIADKISKELMIVTRISNGRNLVGIDKHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKYVYQTSCQHFDSHCFLGNVKRICQGNYFESHLHKEFLDNIQGENSSKQSLKKQKVLLVADDVDKLEQLDALA

HMMPanther: PTHR23155:SF344
21-297 PTHR23155:SF344

TRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFAVVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKKHEAREKDLEKVLKWRQALAALADISGDCSGEDDSKLVDVIADKISKELMIVTRISNGRNLVGIDKHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKYVYQTSCQHFDSHCFLGNVKRICQGNYFESHLHKEFLDNIQGENSSKQSLKKQKVLLVADDVDKLEQLDALA

superfamily: SSF52540
168-361 SSF52540

KISKELMIVTRISNGRNLVGIDKHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKYVYQTSCQHFDSHCFLGNVKRICQGNYFESHLHKEFLDNIQGENSSKQSLKKQKVLLVADDVDKLEQLDALAGDFSGFGPGSVVIITTKDKQLLISYGIQLVYEAEFLTFQKFCRSFRSLAFKKRDDISAAFEWAL

HMMPfam: PF00931
IPR002182
190-350 NB-ARC,NBS
NB-ARC

KHMNELNRLMDLNSNKGKRMVGIWARGGSCRSALAKYVYQTSCQHFDSHCFLGNVKRICQGNYFESHLHKEFLDNIQGENSSKQSLKKQKVLLVADDVDKLEQLDALAGDFSGFGPGSVVIITTKDKQLLISYGIQLVYEAEFLTFQKFCRSFRSLAFKKR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox