PRGDB00067035 (At.71141)

From PRG Wiki
Jump to: navigation, search
At.71141
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337336 (NM_105624)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G69550) mRNA, complete cds

DNA Sequence

GTCGACCACACAAAAGTAAACATCCGTGAAGCTTGCTATTGACTTACTGTAGCGTTGAGTCAATGGAGTCAAGATAATGTGTTCAATAATGTATCACAAATCCATCTTTGTTCATTCATCCTTCGTATAGCTTTGCTGAGAAGTAAAAAATCTCTGTTGATCTTGATCCTCTCTCAGTCTTATGCTAATGGATTCTTCTTTTTTCCTTACCATTGTTGCTGCTGCTTTTGCAATAGGCTTCTTCATCTTTCTTAGAAAGTTGAGAATCCATCAAGAAAACGAAGATGTGGGTTCTTCTTCTACATCTCCTCCATCGTCTTTGGCGTCTTCAACATCTCCTCCATCTACGTTGTCTTCTTCAACATCTCATCCGTCTTCTTCAACTTCTCCTCCATCATCTTTGTCTTGCACCGGGACTCACCATGTATTTCCAAGCTTCCGTGGGGATGACGTTCGCAGAAACTTTCTCAGTCACATTCAAAAGGAGTTTCGGAGAAAAGGAATCACTCCGTTCATCGATAATGAGATTAGGAGAGGAGAATCCATCGGTCCTGAACTCATTAAGGCCATTAGAGAATCTAAGATCGCAATTGTTCTGCTCTCGAGGAACTATGCTTCTTCAAAGTGGTGTCTTGAAGAATTGGTGGAGATTATGAAATGCAAGAAAGAGTTTGGTCTAACAGTGTTTGCCATTTTCTATGAAGTTGATCCATCCCATGTTAAGAAGCTTACCGGAGAATTTGGAGCTGTCTTTCAGAAAACTTGTAAGGGTAGAACAAAGGAGAATATTATGAGATGGAGACAAGCTTTTGAGGAGGTTGCTACAATTGCTGGTTACGATTCAAGAAACTGGGAAAATGAAGCTGCCATGATTGAAGAAATTGCCATTGAAATTTCCAAAAGATTGATTAATTCCTCACCGTTCAGTGGGTTTGAAGGTTTGATTGGGATGAAAGCTCATATAGAAAAGATGAAACAGTTGCTTTGCCTCGATTCAACAGATGAAAGGAGGACGGTTGGTATTTCAGGTCCTTCTGGAATTGGTAAGAGCACTATTGCTAGAGTTCTACATAATCAAATCTCTGATGGTTTTCAAATGAGTGTTTTCATGAAATTCAAACCAAGTTATACAAGACCAATTTGTTCTGATGATCACGATGTGAAGTTGCAATTAGAGCAGCAATTTCTAGCTCAATTGATTAACCAAGAGGATATCAAGATTCATCAGTTAGGAACTGCGCAAAACTTTGTGATGGGAAAGAAAGTGCTTATTGTTCTTGATGGGGTGGATCAATTAGTACAATTACTTGCCATGCCAAAGGCGGTATGCCTCGGTCCTGGATCTCGTATTATCATCACAACACAAGATCAACAACTTTTGAAGGCGTTTCAGATCAAACATATTTACAATGTGGATTTTCCACCAGATCATGAGGCTCTTCAAATCTTCTGCATCCATGCTTTTGGTCATGATTCCCCTGATGATGGTTTCGAGAAGCTTGCTACGAAAGTTACAAGACTTGCTGGTAATCTCCCTTTGGGACTTAGGGTTATGGGTTCTCATTTCCGGGGAATGTCCAAGGAAGATTGGAAAGGGGAACTACCAAGGTTACGGATTCGCCTTGACGGAGAAATAGGGAGCATTTTAAAATTTAGTTACGATGTCTTGGACGACGAAGACAAAGATTTGTTTCTCCATATAGCATGTTTTTTTAACGACGAAGGCATTGATCATACCTTTGAAGATACTCTTCGTCACAAATTCTCAAACGTGCAGCGAGGGCTTCAGGTCTTAGTTCAAAGATCTCTCATATCCGAGGATTTAACTCAACCGATGCATAATCTACTAGTTCAATTGGGTAGAGAAATTGTTCGTAACCAATCCGTTTATGAACCTGGGAAACGTCAATTTCTAGTTGATGGAAAGGAGATTTGTGAAGTACTTACTAGTCATACAGGAAGTGAAAGTGTTATAGGCATAAATTTCGAAGTTTATTGGAGCATGGACGAACTAAATATAAGTGATAGAGTTTTTGAAGGAATGTCTAATCTTCAATTTTTTAGATTCGATGAAAATTCTTATGGAAGATTGCACTTGCCACAAGGTCTAAACTATCTACCTCCAAAACTTAGAATTCTACATTGGGATTACTATCCGATGACAAGTTTGCCTTCTAAGTTTAATCTGAAGTTTCTTGTCAAGATAATATTGAAACACAGTGAGCTCGAGAAACTGTGGGAAGGAATTCAAGTAAGCatttaccattcttttatgaaatttattttattttaatttctatttttGTATAAAATTGTTAGTTTCAAAAATAAAGATGAAAAAACATGATTTTAGCCTTTAAATGGCATTTAAGTTGTTCTC


Protein sequences

Name Description Sequence
At.71141 translated coding region predicted by ESTScan from UniGene At.71141

MDSSFFLTIVAAAFAIGFFIFLRKLRIHQENEDVGSSSTSPPSSLASSTSPPSTLSSSTSHPSSSTSPPSSLSCTGTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLW

Domains

Domain Start-End Description Sequence

Seg: seg
11-21 seg

AAAFAIGFFIF

Seg: seg
36-73 seg

SSSTSPPSSLASSTSPPSTLSSSTSHPSSSTSPPSSLS

superfamily: SSF52200
IPR000157
66-217 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

TSPPSSLSCTGTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGY

ProfileScan: PS50104
IPR000157
76-214 TIR
Toll-Interleukin receptor

GTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATI

HMMSmart: SM00255
IPR000157
77-214 Toll
Toll/interleukin-1 receptor homology (TIR) domain

THHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATI

Gene3D: G3DSA:3.40.50.10140
78-212 no description

HHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVA

HMMPfam: PF01582
IPR000157
80-208 TIR
Toll-Interleukin receptor

VFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAF

HMMPanther: PTHR11017
102-684 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLW

HMMPanther: PTHR11017:SF20
102-684 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLW

superfamily: SSF52540
131-503 P-loop containing nucleoside triphosphate hydrolases

SKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFL

Seg: seg
225-236 seg

EAAMIEEIAIEI

HMMPfam: PF00931
IPR002182
256-514 NB-ARC,NBS
NB-ARC

KAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGI

HMMSmart: SM00382
IPR003593
273-412 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

ERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFP

Gene3D: G3DSA:3.40.50.300
275-358 no description

RTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGK

FPrintScan: PR00364
IPR000767
276-291 DISEASERSIST
Disease resistance protein

TVGISGPSGIGKSTIA

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

FVMGKKVLIVLDGVD

Seg: seg
360-374 seg

VLIVLDGVDQLVQLL

FPrintScan: PR00364
IPR000767
446-460 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSHF

superfamily: SSF52047
607-684 RNI-like,LRR

DELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox