PRGDB00067066 (At.74744)

From PRG Wiki
Jump to: navigation, search
At.74744
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2762904 (T46209)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

9472 Lambda-PRL2 Arabidopsis thaliana cDNA clone 138F19T7, mRNA sequence

DNA Sequence

CTCAGGAGCTTCCGCCTTATTCANAGTGTAGAGGAGGATCCaaaagaaaagaggaaaaaaTGGACTATATGTATGGNCCAGGGAGACACCATCTNTTTGTACCAGGACCAGTGAACATACCGGAACCGGTAATCCGGGCNATGAACCGGAACAACGAGGATTACCGGTCACCAGCCATTCCGGCGCTTACGAAAACATTGTTGGAGGATGTTAAGAAGATATTCAAGACCACATCAGGGACACCTTTNNTTTTTCCCACGGCCGGGACTGGTGCTTNGAAGAGTGCCTTTNCCAACACGTTATCTCCTGGAGACAGGAANTTTTTCGTTTTCTNATTGGNCAATTTAGNNTTGCNCTTGG


Protein sequences

Name Description Sequence
At.74744 translated coding region predicted by ESTScan from UniGene At.74744

MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPXXFPTAGTGAXKSAFXNTLSPGDRXFFVFXLXNLXLXLX

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
1-86 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPXXFPTAGTGAXKSAFXNTLSPGDR

HMMPanther: PTHR21152:SF7
1-86 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPXXFPTAGTGAXKSAFXNTLSPGDR

HMMPanther: PTHR21152
1-86 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPXXFPTAGTGAXKSAFXNTLSPGDR

Gene3D: G3DSA:3.40.640.10
IPR015421
21-87 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPXXFPTAGTGAXKSAFXNTLSPGDRX

Seg: seg
57-73 seg

TTSGTPXXFPTAGTGAX

Seg: seg
92-101 seg

XLXNLXLXLX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox