PRGDB00067084 (Bna.1828)

From PRG Wiki
Jump to: navigation, search
Bna.1828
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 65285036 (CN727234)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brassica napus

Comment?

BNDH5DCT_UP_008_E01_16DEC2003_007 Brassica napus BNDH5DCT Brassica napus cDNA 5', mRNA sequence

DNA Sequence

GAGTATGCTCAAAGCGGACAAATCACAGAAAAAGCAGATGTGTACTCGTTTGGGGTTGTGTTAGTTGAGCTAGTCACTGGACGCAAAGCCATTGACATTACTATGCCGAAAGGCCAGCAATGCCTCACTGAATGGGCACGTCCTCTACTGGAAGAATATGCGGTGGAAGAACTTGTAGATCCGAGGCTTGGTGACCGTTTTGTAGAAAGTGAGGTTATTTGCATGGTTCATGCAGCTTCGTTGTGCATACGTAGAGATCCACATTTGAGGCCACGCATGTCTCAGGTGCTGCGCATACTGGAAGGAGATATGATAATGGATGGGAACTACGCATCAACTCCAGGTTCAGAGGCAGGCTGGAACTAAACCATAACGTAACTGTGTTAGGAAAAGTTAAGTAAAAGTCATCTGTTTTCTCAGTGATGTGGTCCAAAGCTGGCAGGAAAGCtttttgagccttttttgttttgtttgTATAGTGGGGTAAGATGCAAACAGAGTTGCTAAATATGTTATCAAGGGATTTGAGaaaaaaattggtaaaagggaaattattaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaCATGTC


Protein sequences

Name Description Sequence
Bna.1828 translated coding region predicted by ESTScan from UniGene Bna.1828

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLRILEGDMIMDGNYASTPGSEAGWN

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-100 no description

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLRIL

superfamily: SSF56112
IPR011009
1-108 Protein kinase-like (PK-like)
Protein kinase-like domain

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLRILEGDMIMDG

HMMPfam: PF07714
IPR001245
1-98 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLR

HMMPanther: PTHR24420
1-119 FAMILY NOT NAMED,FAMILY NOT NAMED

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLRILEGDMIMDGNYASTPGSEAG

HMMPanther: PTHR24420:SF821
1-119 SUBFAMILY NOT NAMED

EYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELVDPRLGDRFVESEVICMVHAASLCIRRDPHLRPRMSQVLRILEGDMIMDGNYASTPGSEAG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox