PRGDB00067090 (Bna.2158)

From PRG Wiki
Jump to: navigation, search
Bna.2158
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145698395 (AB270767)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brassica napus

Comment?

Brassica napus BnSRK-1 mRNA for S receptor kinase, complete cds

DNA Sequence

ATGAAAGGTGTACGAAACATCTATGACCACCATTCTTACACCTTCTTGCTCGTCTTCGTTGTCATGATTCTATTTCATCCTGCCCTTTCGATCTATATCAACACTTTGTCGTCTACAGAATCTCTTACAATTTCAAACAATAGAACACTTGTATCTCCCGGTGATGTTTTCGAGCTCGGTTTCTTCAAAACCACCTCAAGTTCTCGTTGGTATCTCGGGATATGGTACAAGCAATTGCCCGAGAAAACCTATGTATGGGTTGCCAACAGGGATAACCCTCTCCCCAATTCCATTGGAACCCTCAAAATATCCAACATGAACCTTGTCCTCCTTGATCACTCTAATAAATCTGTTTGGTCCACGAATCTTACTAGACGTAATGAGAGAACTCCGGTGATGGCAGAGCTTCTCGCTAATGGAAACTTCGTGATGAGAGACTCCAATAACAACGATGCAAGTGAATTCTTGTGGCAAAGTTTCGATTACCCTACAGATACTTTGCTTCCAGAGATGAAACTGGGTTACAACCTCAAAAAAGGGCTAAACAGGTTCCTTATATCATGGAGAAGTTCAGATGATCCGTCAAGCGGGGATTACTCGTACAAGCTCGAACCCCGAAGGCTTCCTGAGTTTTATCTACTGCAAGGAGACGTTCGAGAGCATCGGAGTGGTCCATGGAACGGAATCCGATTTAGTGGGATACTAGAGGACCAAAAGCTGAGTTACATGGAGTACAATTTCACAGAGACTAGTGAGGAGGTCGCTTATACATTCCGAATGACCAACAACAGCTTCTACTCGAGATTGACACTAAGCTCCACAGGGTATTTTGAGCGACTGACGTGGGCTCCGTCATCAGTGATATGGAACGTCTTCTGGTCTTCTCCAGCAAACCCCCAGTGCGATATGTACAGGATGTGTGGGCCTTACTCTTACTGTGACGTGAACACATCACCATCGTGTAACTGTATACAAGGGTTCGATCCCAGGAATTTGCAGCAGTGGGCTCTGAGAATCTCATTAAGGGGGTGTAAAAGGAGGACGCTGCTGAGCTGCAATGGAGATGGTTTTACCAGGATGAAGAATATGAAGTTGCCAGAAACTACGATGGCCATTGTCGACCGCAGTATAGGTGAGAAAGAATGTAAGAAGAGGTGCCTTACCGATTGTAATTGTACCGCGTTTGCAAATGCGGATATCCGGAATGGTGGGACGGGTTGTGTGATTTGGACTGGAAATCTCGCTGATATGCGGAATTACGTTGCTGACGGTCAAGACCTTTATGTCAGATTGGCTGCGGCTGATCTCGTTAAGAAGAGTAACGCGAATGGGAAAATCATAAGTTTGATTGTTGGAGTTAGTGTTCTGCTTCTTCTGATCATGTTTTGCCTCTGGAAAAGGAAACAAAATCGAGAAAAATCAAGTGCAGCATCTATTGCAAATCGACAGAGAAACCAAAATTTGCCTATGAACGGGATAGTACTATCAAGCAAGAGACAGTTGTCTGGAGAGAACAAAATTGAGGAGCTGGAACTTCCATTGATAGAGTTGGAAGCTATTGTCAAAGCCACCGAAAATTTCTCCAATTCTAACAAAATTGGACAAGGTGGTTTTGGTATTGTTTACAAGGGGATATTACTTGACGGGCAAGAAATCGCGGTAAAAAGGCTATCAAAGACGTCAGTTCAAGGGGTTGATGAGTTTATGAATGAGGTGACATTAATCGCGAGGCTTCAACATGTAAATCTTGTCCAAATTCTTGGCTGTTGCATTGACGCAGATGAGAAGATGCTGATATATGAGTATTTGGAAAATTTAAGCCTCGATTCTTATCTCTTCGGAAAAACTCGAAGGTCTAAGCTAAATTGGAAGGAGAGATTCGACATTACCAATGGTGTTGCTCGAGGGCTTTTATATCTTCATCAAGACTCCCGCTTTAGGATAATCCACAGAGATTTGAAAGTAAGTAACATTTTGCTTGATAGAAATATGGTCCCAAAGATCTCGGATTTTGGAATGGCCAGGATATTTGAAAGAGACGAGACGGAAGCTAACACAATGAAGGTGGTCGGAACTTACGGCTACATGTCCCCAGAGTACGCAATGGGTGGGATATTCTCGGAAAAATCAGATGTTTTCAGTTTTGGAGTCATGGTTCTTGAAATTATTACTGGGAAGAGAAACAGAGGATTCGACGAAGACAATCTTCTAAGCTGTGCATGGAGAAATTGGAAGGAAGGAAGAGCGCTAGAAATAGTAGATCCAGTCATCGTAAATTCATTTTCACCACTGTCATCACCATTTCAACTACAAGAAGTCCTAAAATGCATACAAATTGGTCTCTTGTGTGTTCAAGAACTTGCAGAGAACAGACCAACCATGTCGTCTGTGGTTTGGATGCTTGGCAATGAAGCAACAGAGATTCCTCAGCCTAAATCGCCAGGTTGCGTCAGAAGAAGTCCTTACGAACTTGATCCTTCATCAAGTAGGCAGCGCGACGATGATGAATCCTGGACGGTGAACCAGTACACCTGCTCAGTAATCGATGCCCGGTAATATGAAAGCTGTGAGAATGTTCATTTAATTAAAAATTACTAAATGGTGTGACTCAATACCATATGTGAAAGAAGTAAAATAAATTCTCAATAGATAAAGTATGTTATTTTGATAACAAATTCTTGCGTCTTTTTTCTGGCGGTTCAAAGtttttttttttCCTCGATGATATTAAACCAAATTGAAAGGACTACAAGGTCGGATACGTTTTTAGGACACCAAAACCAGCTTTCAAACAGATGAAACTGGAGACATAAGCTCCTA


Protein sequences

Name Description Sequence
Bna.2158 translated coding region predicted by ESTScan from UniGene Bna.2158

MKGVRNIYDHHSYTFLLVFVVMILFHPALSIYINTLSSTESLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLRGCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRLAAADLVKKSNANGKIISLIVGVSVLLLLIMFCLWKRKQNREKSSAASIANRQRNQNLPMNGIVLSSKRQLSGENKIEELELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGNEATEIPQPKSPGCVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-836 PTHR24420,FAMILY NOT NAMED

MKGVRNIYDHHSYTFLLVFVVMILFHPALSIYINTLSSTESLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLRGCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRLAAADLVKKSNANGKIISLIVGVSVLLLLIMFCLWKRKQNREKSSAASIANRQRNQNLPMNGIVLSSKRQLSGENKIEELELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGNEATEIPQPKSPGCVRRSPYELDPSSSRQRDDDE

HMMPanther: PTHR24420:SF432
1-836 PTHR24420:SF432,SUBFAMILY NOT NAMED

MKGVRNIYDHHSYTFLLVFVVMILFHPALSIYINTLSSTESLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLRGCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRLAAADLVKKSNANGKIISLIVGVSVLLLLIMFCLWKRKQNREKSSAASIANRQRNQNLPMNGIVLSSKRQLSGENKIEELELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGNEATEIPQPKSPGCVRRSPYELDPSSSRQRDDDE

HMMPIR: PIRSF000641
IPR024171
10-851 SRK
S-receptor-like serine/threonine-protein kinase

HHSYTFLLVFVVMILFHPALSIYINTLSSTESLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLRGCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRLAAADLVKKSNANGKIISLIVGVSVLLLLIMFCLWKRKQNREKSSAASIANRQRNQNLPMNGIVLSSKRQLSGENKIEELELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGNEATEIPQPKSPGCVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR

ProfileScan: PS50927
IPR001480
35-157 BULB_LECTIN
Bulb-type lectin domain

TLSSTESLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLW

HMMSmart: SM00108
IPR001480
41-163 B_lectin
Bulb-type lectin domain

SLTISNNRTLVSPGDVFELGFFKTTSSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYP

superfamily: SSF51110
IPR001480
66-228 B_lectin
Bulb-type lectin domain

SSSRWYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNG

Gene3D: G3DSA:2.90.10.10
IPR001480
80-165 Bulb-type_lectin_dom
Bulb-type lectin domain

PEKTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTD

HMMPfam: PF01453
IPR001480
82-195 B_lectin
Bulb-type lectin domain

KTYVWVANRDNPLPNSIGTLKISNMNLVLLDHSNKSVWSTNLTRRNERTPVMAELLANGNFVMRDSNNNDASEFLWQSFDYPTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
197-233 Bulb-type_lectin_dom
Bulb-type lectin domain

GDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIRFSG

HMMPfam: PF00954
IPR000858
221-331 S_locus_glycop
S-locus glycoprotein

HRSGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRN

ProfileScan: PS50948
IPR003609
352-432 PAN
Apple-like

CNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRLA

HMMPfam: PF08276
IPR013227
352-417 PAN_2
PAN-2 domain

CNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADM

HMMSmart: SM00473
IPR003609
352-431 PAN_AP
Apple-like

CNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRNGGTGCVIWTGNLADMRNYVADGQDLYVRL

HMMPfam: PF12398
IPR022126
476-517 DUF3660
S-locus, receptor kinase

AASIANRQRNQNLPMNGIVLSSKRQLSGENKIEELELPLIEL

superfamily: SSF56112
IPR011009
497-801 Kinase_like
Protein kinase-like domain

SKRQLSGENKIEELELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWML

Gene3D: G3DSA:3.30.200.20
511-602 G3DSA:3.30.200.20

ELPLIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEY

ProfileScan: PS50011
IPR000719
527-806 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGNEAT

HMMPfam: PF07714
IPR001245
530-799 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVW

PatternScan: PS00107
IPR017441
533-555 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGIVYKGILLDGQEIAVK

Gene3D: G3DSA:1.10.510.10
603-802 G3DSA:1.10.510.10

LENLSLDSYLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFDEDNLLSCAWRNWKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLG

PatternScan: PS00108
IPR008271
648-660 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKVSNILL

HMMPfam: PF11883
IPR021820
803-851 DUF3403
S-locus receptor kinase, C-terminal

NEATEIPQPKSPGCVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox