PRGDB00067106 (Bna.4153)

From PRG Wiki
Jump to: navigation, search
Bna.4153
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 65299651 (CN829865)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brassica napus

Comment?

EL3773R Brassica embryo library (EL) Brassica napus cDNA clone EL3773 5', mRNA sequence

DNA Sequence

CGAGAAGGCGACGGATAGCTTTAACAAGAACAGAGTTCTTGGGCAGGGAGGTCAAGGTACGGTCTACAAAGGAATGCTGGTGGATGGGCGTATCGTCGCTGTGaaaagatctaaagttttggatgaagacaaagtcgaggagttcatcaatgaagtcagtgttctcTCGCAGATTAACCATAGGAACGTCGTGAAACTCATGGGGTGTTGTCTGGAGACGGAGGTTCCTATCTTGGTTTATGAGCATATTCCAAACGGAGACTTATTCAAGCGGCTGCACGATGATTCTGATGATTACATAATGACTTGGGAAGTGCGTTTGCGGATGGCTGGGGAGATTGCAGGAGCGCTTGCTTActtgcactcggctgcatctactcctgtctatcatAGAGATATCAAGACCATAAACATACTTTTGGACGAGAAGTATCGAGCCAAAGTGTCGGATTTTGGTACTTCGAGGTCTATCAACATAGATCAGACTCACTTGACAACTCTAGTCGCAGGTACTTTCGGATACTTGGATCCGGAGTACTTTCAGACCAGCCAGTttacgaataaaagtgatgtttatagtttcggggttgtcttggttgagcttataACCGGAGAAAAATCGTTTTCTGTTATGCGGTCTGAAGAAAAAGAGGGCT


Protein sequences

Name Description Sequence
Bna.4153 translated coding region predicted by ESTScan from UniGene Bna.4153

XEKATDSFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEKEGX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-209 Protein kinase-like (PK-like)
Protein kinase-like domain

EKATDSFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSF

Gene3D: G3DSA:3.30.200.20
2-69 no description

EKATDSFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMG

HMMPanther: PTHR24420
2-218 FAMILY NOT NAMED,FAMILY NOT NAMED

EKATDSFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEKE

HMMPanther: PTHR24420:SF444
2-218 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EKATDSFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEKE

ProfileScan: PS50011
IPR000719
8-220 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEKEGX

HMMSmart: SM00219
IPR020635
8-217 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEK

HMMSmart: SM00220
IPR002290
8-218 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVMRSEEKE

HMMPfam: PF00069
IPR017442
9-212 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVSVLSQINHRNVVKLMGCCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVM

Gene3D: G3DSA:1.10.510.10
70-212 no description

CCLETEVPILVYEHIPNGDLFKRLHDDSDDYIMTWEVRLRMAGEIAGALAYLHSAASTPVYHRDIKTINILLDEKYRAKVSDFGTSRSINIDQTHLTTLVAGTFGYLDPEYFQTSQFTNKSDVYSFGVVLVELITGEKSFSVM

PatternScan: PS00108
IPR008271
129-141 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDIKTINILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox