PRGDB00067108 (Bna.4325)

From PRG Wiki
Jump to: navigation, search
Bna.4325
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 65300109 (CN830323)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brassica napus

Comment?

EL407 Brassica embryo library (EL) Brassica napus cDNA clone EL407 complete, mRNA sequence

DNA Sequence

CTGTGGTGGTGAAGAGGCTTAAAGAAGTAGCGGCTGGGAAAAGAGAGTTCGAGCAGCAGATGGAAGCTGTGGGAAGGATCAGCCCGCACGGGAATGTAGCTCCTCTCCGTGCTTATTACTTCTCTAAAGACGAGAAGCTCCTCGTGTATGATTACTACCAAGGAGGCAACTTCTCCATGCTTCTTCACGGAAACAACGAAGGAGGAAGAGGTGCATTGGACTGGGAACAAAGGCTAAAGATCTGTTTAGGAGCTGCAAAAGGAATAGCTCACATACACTCTTCATCCGGTGCCAAGCTCCTCCACGGTAACATCAAATCACCAAACGTCCTCTTAATGCAAGACCTCAACGCCTGCGTCTCGGACTACGGCATAGCTCCTCTGATGAGCCACCACACCTTGCTCCCATCAAGAAGCTTAGGATACAGAGCGCCTGAAGCCATAGAGACACGGAAACACACTCAAAAATCCGACGTGTACAGTTTTGGCGTGCTGTTGCTCGAAATGCTGACGGGGAAAGCGGCAGGGAAGACGACGGGGCACGAGGAAGTGGTGGATTTGCCCAAGTGGGTGCAGTCGGTGGTGAGAGAGGAGTGGACTGGGGAAgtgtttgacgtggagcttataaagcagcagcacaacgttgaggaagagatggtgcagatgttgcaggtggcgatggcttgtgtgtcgaagcatccggattctaggccttccatggaggaagttgttaacatgatggaggaggtaaggccttcaaatggctctggtgctggctctggcaacagggcctcttcgcctgagatgatcagaagctctgatagcccggtttagattggttattattttctttctgaaatcattatttatttcgacttttttacttctttgggaataaaccttttcgtagttgactaattcagcatgtgatttgttctaatcattacctggaaaagtaGTGT


Protein sequences

Name Description Sequence
Bna.4325 translated coding region predicted by ESTScan from UniGene Bna.4325

XVVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVRPSNGSGAGSGNRASSPEMIRSSDSPV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-250 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEV

HMMSmart: SM00219
IPR020635
1-247 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XVVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMM

HMMSmart: SM00220
IPR002290
1-247 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XVVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMM

HMMPfam: PF07714
IPR001245
2-246 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNM

Gene3D: G3DSA:3.30.200.20
2-55 no description

VVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQG

superfamily: SSF56112
IPR011009
2-247 Protein kinase-like (PK-like)
Protein kinase-like domain

VVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMM

HMMPanther: PTHR24420
2-252 FAMILY NOT NAMED,FAMILY NOT NAMED

VVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVRP

HMMPanther: PTHR24420:SF547
2-252 SUBFAMILY NOT NAMED

VVVKRLKEVAAGKREFEQQMEAVGRISPHGNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVRP

Gene3D: G3DSA:1.10.510.10
60-249 no description

MLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEE

Seg: seg
240-250 seg

MEEVVNMMEEV

Seg: seg
251-267 seg

RPSNGSGAGSGNRASSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox