PRGDB00067414 (Bol.3332)

From PRG Wiki
Jump to: navigation, search
Bol.3332
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 308624434 (DK465946)
Gene Class Unknown
Domain Type
Gene Species Brassica oleracea

Comment?

DK465946 full-length kale cDNA library (seedlings) Brassica oleracea var. acephala cDNA clone KALE-027D09 5', mRNA sequence

DNA Sequence

GAGGAGCTTCCGCCTTACTCAGAGTGTGGAGCAGGAGGAGAAACAAGAAAAGGGGAAAAATGGACTATATGAATGGACCAGGGAGACACCATCTTTTCGTACCAGGACCAGTGAACATACCGGAACAGGTGATCCGGGCGATGAACAGAAACAACGAGGATTACCGTTCACCAGCCATCCCCGCACTTACAAAAACGTTGTTGGAGGACGTGAAGAAGATATTCAAGACAACATCTGGGACACCGTTTATGTTTCCGACTACTGGTACTGGTGCTTGGGAGAGTGCCTTGACCAACACGCTATCTCCTGGAGATAGGATCGTCTCGTTTCTGATAGGGCAATTCAGCTTGCTGTGGATTGACCAGCAGAAGAGGCTAAATTTCAACGTTGATGTGGTGGAGAGTGACTGGGGACAAGGTGCTAATCTCCAAGTCTTGGCCTCAAAGCTCTCACAGGACCAAAATCATTCCATCAAAGCCATTTGCATTGTCCACAACGAGACCGCGACTGGAGTCACTAATGACATCTCTGCTGTCCGAACCCTCCTCGATCACTACAAGCACCCGGCTTTGCTGCTTGTGGACGGTGTGTCGTCCATATGTGCGCTTGATTTTCGAATGGATGAGTGGGGGAGTGGATGTGGCCTTGACCGGATCTCAGAAGGCTTTATCTCTTCCAACAGGCTTGGTATTGTGTGCGCCAGTCCAAAAGCTTTGGAAGCTACCAAAACCTCAAATCCCTCAAAGTCTTCTTTGATTGGAATGACTACCTCAAGTTTTACAGCTCGGTACATATTGGCCATACACACCTTCCATTCAACTCCTTTACGTCTAGAGCTGCGCTGATCTTATCTTTGAGACGACTTGAGATGTCATCGCCGTCATGCCGTTTGGAAAGCCACACGG


Protein sequences

Name Description Sequence
Bol.3332 translated coding region predicted by ESTScan from UniGene Bol.3332

MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGSGCGLDRISEGFISSNRLGIVCASPKALEATKTSNPSKSSLIGMTTSSFTARYILAIHTFHSTPLRLELR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-230 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGSGCGLDRISEGFISSNRLGIVCASPKALEATKTSNPSKS

HMMPanther: PTHR21152
1-230 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGSGCGLDRISEGFISSNRLGIVCASPKALEATKTSNPSKS

superfamily: SSF53383
IPR015424
7-191 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWG

HMMPfam: PF00266
IPR000192
12-191 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWG

Gene3D: G3DSA:3.40.640.10
IPR015421
21-226 no description
Pyridoxal phosphate-dependent transferase, major r

PEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGSGCGLDRISEGFISSNRLGIVCASPKALEATKTSN

Seg: seg
57-71 seg

TTSGTPFMFPTTGTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox