PRGDB00067453 (Bol.18945)

From PRG Wiki
Jump to: navigation, search
Bol.18945
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 4741218 (Y18260)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Brassica oleracea

Comment?

Brassica oleracea mRNA for SRK15 protein, partial

DNA Sequence

TTACCACCATTCTTACACCTTCTCGTTCTTGCTAGTCTTCCTTGTCTTGATTCTATTTCATCCTGCCCTTTCGATCTATGTCAACACTTTGTCGTCTTCAGAGTCTCTCACAATCTCGAGCAATAGAACACTTGTATCTCACGGTGGAGTCTTCGAGCTTGGTTTCTTCAAACCCTTGGGACGGTCGCGTTGGTATCTCGGAATATGGTATAAGAAAGTCTCCCAGAAAACCTACGCATGGGTCGCCAACAGAGACAGCCCTCTCTCCAATTCCATTGGAACCCTCAAAATCTCTGGCAACAATCTTGTCCTGCTAGGTCAGTCTAATAACACTGTTTGGTCGACAAATCTTACTAGAGAAAATGTGAGATCACCAGTGATAGCAGAGCTTCTTCCCAACGGTAATTTTGTAATGAGATACTCCAGCAACAAAGACTCAAGTGGATTCTTGTGGCAGAGTTTCGATTTTCCGACAGATACTTTACTTCCGGAGATGAAACTAGGTTACGATTTCAAAACAGGGCGCAACAGGTTCCTTACATCATGGAGATCCTATGATGATCCGTCAAGCGGGAAATTCACCTACGAACTGGACATACAAAGGGGATTGCCTGAGTTTATTCTTATAAATCGATTTTTGAATCAACGTGTTGTAATGCAAAGGAGCGGTCCTTGGAATGGAATCGAGTTTAATGGCATACCGGAGGTGCAAGGATTAAATTACATGGTTTACAATTATACGGAGAACAGTGAGGAGATCGCTTACACGTTCCATATGACCAACCAAAGCATCTACTCCAGATTGACAGTCACTGACTATGCACTCAATCGATACACGCGGATCCCGCCATCATGGGGATGGAGCATGTTCTGGAGTTTACCAACGGACGTGTGCGATTCTCTTTACTTCTGTGGATCTTATTCTTACTGTGACCTAAACACGTCACCTTACTGTAACTGTATTAGAGGGTTCGTTCCCAAGAACCGGCAGCGGTGGGACTTGAGAGACGGATCACATGGGTGTGTGAGGAGGACTCAGATGAGCTGTAGTGGAGATGGGTTTTTGCGGCTAAACAATATGAAGTTGCCGGATACTAAGACGGCGACTGTGGATCGGACAACTGATGTGAAAAAATGTGAAGAGAAGTGTCTTAGCGATTGTAACTGTACGTCGTTTGCGACTGCAGATGTTCGAAACGGCGGATTGGGTTGTGTGTTTTGGACCGGAGATCTCGTTGAGATCCGGAAACAAGCCGTCGTTGGTCAAGATCTTTACGTCAGATTGAATGCTGCTGATCTAGCCTCGGGTGAGAAGAGAGACCGAACTAAAAAAATCATAGGTTGGAGTATTGGAGTCACCGTTATGCTTATTCTGAGTGTTATCGTGTTCTGCTTTTGGAGGAGAAGACAGAAGCAAGCAAAAGCAGATGCAACACCTATTGTGGGAAATCAAGTTCTAATGAACGAGGTGGTGTTACCAAGAAAGAAGATAAATTTTTCTGGTGAGGACGAAGTAGAAAATTTGGAACTTTCATTGGAGTTTGAAGCTGTTGTCACAGCCACCGAACATTTCTCTGATTTTAACAAGGTCGGAAAAGGTGGTTTTGGTGTTGTTTACAAGGGAAGGTTAGTTGACGGGCAAGAAATTGCAGTTAAGAGACTATCAGAAATGTCAGCTCAAGGTACCGATGAGTTCATGAACGAAGTCAGGCTAATTGCAAAGCTTCAGCACAATAATCTTGTCCGACTTCTTGGCTGTTGTGTTTATGAGGGCGAGAAGATCTTAATTTACGAGTACTTGGAGAATCTAAGCCTCGACTCTCATCTCTTTGATGAAACCAGGAGCTGTATGTTAAATTGGCAAATGAGATTTGATATTATCAATGGTATTGCCCGAGGGCTTCTGTATCTTCACCAAGATTCACGGTTTAGAATCATCCATAGGGATTTGAAAGCAAGCAATGTCTTGCTTGATAAAGATATGACCCCAAAAATTTCAGACTTCGGAATGGCAAGGATCTTTGGACGGGATGAGACGGAAGCTGACACGAGGAAGGTGGTCGGAACTTATGGCTACATGTCTCCAGAATATGCGATGAACGGGACATTCTCGATGAAGTCAGATGTGTTCAGTTTTGGGGTCTTGCTTCTTGAAATTATAAGTGGCAAGAGGAACAAAGGCTTCTGCGACTCGGATAGTAATCTTAATCTTCTCGGATGTGTGTGGAGGAATTGGAAAGAAGGTCAAGGTCTAGAGATAGTAGACAGGGTCATCATAGATTCTTCATCACCAACGTTCAGGCCACGTGAAATCTTAAGATGCTTACAAATTGGCCTCTTGTGTGTTCAAGAACGTGTAGAGGATAGACCAATGATGTCGTCAGTAGTTTTGATGCTCGGAAGTGAAACTGCATTGATTCCTCAACCTAAACAGCCAGGTTATTGCGTCAGCCAAAGTTCTCTTGAAACTTATTCTAGTTGGAGTAAACTGCGTGACGATGAAAATTGGACAGTGAACCAAATCACCATGTCGATCATTGACGCTCGGTAATATGATAGTCTTTGATAATATTCTCATTATTAAAGTTTTACTAAATGGAAAAAATGAGTTTTAACAAATTGAGTGACAATGCGTGCGAAACTCCTCAGTCTCTATCGAAATTTTCATATATCCTCTGATATTCTCTCGATCTGGTTTCTTTATTTCGAGTCAACTCACAGTCAGCAACTGCAGCAACCATCTCAACACGTCAACACCGGCAATTCAACGACAACCACAGTACATATTTTTTACTCTGTTTTTGTAAGCTCAGGAGCTTGGAAAAAACACACGTTATTCTCAGTATAGTAAATTTCAGTCATTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Bol.18945 translated coding region predicted by ESTScan from UniGene Bol.18945

XYHHSYTFSFLLVFLVLILFHPALSIYVNTLSSSESLTISSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRVVMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVTDYALNRYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRDGSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVEIRKQAVVGQDLYVRLNAADLASGEKRDRTKKIIGWSIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQVLMNEVVLPRKKINFSGEDEVENLELSLEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLGSETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR

Domains

Domain Start-End Description Sequence

Seg: seg
8-20 seg

FSFLLVFLVLILF

HMMPanther: PTHR24420:SF432
10-850 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FLLVFLVLILFHPALSIYVNTLSSSESLTISSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRVVMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVTDYALNRYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRDGSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVEIRKQAVVGQDLYVRLNAADLASGEKRDRTKKIIGWSIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQVLMNEVVLPRKKINFSGEDEVENLELSLEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLGSETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR

HMMPanther: PTHR24420
10-850 FAMILY NOT NAMED,FAMILY NOT NAMED

FLLVFLVLILFHPALSIYVNTLSSSESLTISSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRVVMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVTDYALNRYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRDGSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVEIRKQAVVGQDLYVRLNAADLASGEKRDRTKKIIGWSIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQVLMNEVVLPRKKINFSGEDEVENLELSLEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLGSETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR

ProfileScan: PS50927
IPR001480
30-152 BULB_LECTIN
Bulb-type lectin domain

TLSSSESLTISSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLW

Seg: seg
30-41 seg

TLSSSESLTISS

HMMSmart: SM00108
IPR001480
36-158 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SLTISSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFP

superfamily: SSF51110
IPR001480
67-189 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKTGRNRFLTSWRSYDDP

HMMPfam: PF01453
IPR001480
77-190 B_lectin
Bulb-type lectin domain

KTYAWVANRDSPLSNSIGTLKISGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
191-232 no description
Bulb-type lectin domain

SGKFTYELDIQRGLPEFILINRFLNQRVVMQRSGPWNGIEFN

HMMPfam: PF00954
IPR000858
222-329 S_locus_glycop
S-locus glycoprotein

RSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVTDYALNRYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKN

HMMPfam: PF08276
IPR013227
350-414 PAN_2
PAN-2 domain

CSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVE

ProfileScan: PS50948
IPR003609
350-430 PAN
Apple-like

CSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVEIRKQAVVGQDLYVRLN

HMMSmart: SM00473
IPR003609
350-429 divergent subfamily of APPLE domains
Apple-like

CSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVEIRKQAVVGQDLYVRL

HMMPfam: PF12398
IPR022126
478-515 DUF3660
S-locus, receptor kinase

ATPIVGNQVLMNEVVLPRKKINFSGEDEVENLELSLEF

superfamily: SSF56112
IPR011009
495-800 Protein kinase-like (PK-like)
Protein kinase-like domain

RKKINFSGEDEVENLELSLEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLML

Gene3D: G3DSA:3.30.200.20
513-586 no description

LEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLG

ProfileScan: PS50011
IPR000719
525-780 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGL

HMMSmart: SM00220
IPR002290
525-792 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPM

HMMSmart: SM00219
IPR020635
525-800 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLML

HMMPfam: PF07714
IPR001245
529-799 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLM

Seg: seg
530-542 seg

KVGKGGFGVVYKG

PatternScan: PS00107
IPR017441
531-553 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGGFGVVYKGRLVDGQEIAVK

Gene3D: G3DSA:1.10.510.10
587-726 no description

CCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN

PatternScan: PS00108
IPR008271
646-658 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL

HMMPfam: PF11883
IPR021820
802-850 DUF3403
S-locus receptor kinase, C-terminal

SETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox