PRGDB00067632 (Bol.25615)

From PRG Wiki
Jump to: navigation, search
Bol.25615
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 308724238 (DK495462)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brassica oleracea

Comment?

DK495462 full-length kale cDNA library Brassica oleracea var. acephala cDNA clone KALE-104F16 5', mRNA sequence

DNA Sequence

GGCACAGACACAGTTCACTGAAACCCCTCTTCTTTAAATTCCCTTTCTTTCTTTCATTTAAATTTAATTAATCTCCTGTTTTTTTTTCCCTAGATTCCGTGATTTCGATTCAACACTCGATGCGGTGACAATTATAGATTTTGCCGGCAAAGTTTTTGTTTTTGCGAAGAAACAGGAAACGATGTCGGTGTTCGACGCTGCTATCGTCAACACGGAGCTTTCCAAACCGACGTCGATCTTCGGTCTCCGGCTATGGGTCGTCATCGGAATCTTACTCGGATCTCTAATCGTCATCGCCCTCTTCCTCCTCTCCCTCTGCCTCACCTCCCGCCGCAAAAACCGCAAACCGCGAGCCGACTTCGCCTCCGCCGCCGTGGCAACGCCGCCGATTTCGAAGGAGATTAAGGAGATCGTTCCGGCGCCGGCGGAGATCCAGGTGGACATAGGGAAGATGGAGCACCGAGTGGTGTTCTCGGATCGGGTGTCGAGCGGGGAGAGCAGAGGAACGGCGAGTGCGAGCGAGACGGCGTCGTATTCGGGGAGCGGGAACGTGGGGCCGGAGGTGTCGCATCTGGGATGGGGGAGGTGGTATACTCTGAGGGAGCTTGAGGCGGCGACGAATGGGCTGTGTGAAGAGAATGTGATCGGAGAAGGCGGTTACGGGATAGTGTATCGTGGGGTGTTAACCGACGGTACTAAAGTCGCGGTCAAGAACTTGCTTAATAACAGGGGACAGGCAGAGAAGGAATTCAAAGTAGAAGTGGAAGTGATTGGGCGTGTACGGCACAAGAATCTCGTTCGGCTTTTAGGTTATTGCATTGAAAGTGCTTACAGGATGCTGGTGTATGAC


Protein sequences

Name Description Sequence
Bol.25615 translated coding region predicted by ESTScan from UniGene Bol.25615

MSVFDAAIVNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAVATPPISKEIKEIVPAPAEIQVDIGKMEHRVVFSDRVSSGESRGTASASETASYSGSGNVGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF688
23-223 SUBFAMILY NOT NAMED

RLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAVATPPISKEIKEIVPAPAEIQVDIGKMEHRVVFSDRVSSGESRGTASASETASYSGSGNVGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

HMMPanther: PTHR24420
23-223 FAMILY NOT NAMED,FAMILY NOT NAMED

RLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAVATPPISKEIKEIVPAPAEIQVDIGKMEHRVVFSDRVSSGESRGTASASETASYSGSGNVGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

Seg: seg
26-40 seg

VVIGILLGSLIVIAL

superfamily: SSF56112
IPR011009
121-223 Protein kinase-like (PK-like)
Protein kinase-like domain

SGNVGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

Gene3D: G3DSA:3.30.200.20
124-223 no description

VGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

ProfileScan: PS50011
IPR000719
149-223 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LCEENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVYD

HMMPfam: PF07714
IPR001245
152-222 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ENVIGEGGYGIVYRGVLTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCIESAYRMLVY

PatternScan: PS00107
IPR017441
155-177 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGIVYRGVLTDGTKVAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox