PRGDB00067719 (Can.2666)

From PRG Wiki
Jump to: navigation, search
Can.2666
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 28151106 (CB164980)
Gene Class Unknown
Domain Type
Gene Species Capsicum annuum

Comment?

KS06015830 KS06 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

TTCGAGCGGCCGCCCGGGCAGGTACTGAAATCGTGAAAAGGGCATGGAAGCGATACAACTTAAGCTTAGGTCTCGGCCTAAACAAAGTTGCAGGAAAGGTATTCATAATACGACATCTCGGCAACTTGAACGAGTTGCAACTATTGGGATGTCTTGCTGGAGTTGAAATGGTACTTAAGGATCTCGCTCTCGTCGAGTCTTTCTCAATGTGACTGAGAACCCAGAAAGCACCTATCTTGTCGAGATCTTAAGAGGTTACGAGCCACTGAATTGCCACTGTCGCAGAAGACCGTAGCATCTGACCCATTTGTCCTTCACTTAAAGATACAGACGCTTTTTTACGTGACCAATGAGTCCGGGTACTAAGATATGAGATACCTTAGCCTTTAGCCTCTTGTAGTTGTAACAAGACTACGAACTAGACTCCTTTCTGCACTCTCCTTGTCCAGACTTAGCACGAACACTCACGGTAGTGCGTGTCGGTAGTCGTATGTCGCTGTATTTGTAACTATTACGTGAGGCTATCTATGACTACAGTCTTCTGGTGTGGTCAGGCATATGCGACTAATACCCCGATCTCCACTTCGATCTCAGTGTCTTCGTCATGAGCAATGTTTGAGCTATTAAGTAAACACTTAGTCTGCCACCAGGATCTATTGTTAGACATGTAGATACGCATTCCGGTCAGTTCGCAGTATGATATTAAGTCCGAGGTTTGGGACATTATTTCGCGACTCTACATACCCCGGGTAGAAAGAATCTTAGAAACACACGCAAGGGACTCACGTATAGGATACGACCTTACTTTAAGAATCTTGAGGGAGCTCACTGTTGGTTCGTGACGTTATCGTCGCTTACTATGTATAAGAGCATTATGACTAGCGTTGTTAGCGCTGTGCTTGTAACGATCTATCAGTTGTTAGTCTTAGCGTAGCTCTGCTGCGGGAGGCATTGGACGAATCGATACTATACGATCGTGTTTCTAGGTACGTATAAGCCCAGTATCGTCACGTAGTGATTCTCTCACTCGATAATATGTGTATTGCGAATGTATCGTAACACTATAGTGATATGACTGACATAGGTCAGCGTCTTATGGCACGAGTCTGTGATACGTATATCTCTCAGCTTCT


Protein sequences

Name Description Sequence
Can.2666 translated coding region predicted by ESTScan from UniGene Can.2666

XRAAARAGTEIVKRAWKRYNLSLGLGLNKVAGKVFIIRHLGNLNELQLLGCLAGVEMVLKDLALVESFSMXLRTQKAPSCRDLKRLRATELPLSQKTVASDPFVLHLKIQTLFYVTNESGY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
8-62 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GTEIVKRAWKRYNLSLGLGLNKVAGKVFIIRHLGNLNELQLLGCLAGVEMVLKDL

HMMPanther: PTHR21152
8-62 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

GTEIVKRAWKRYNLSLGLGLNKVAGKVFIIRHLGNLNELQLLGCLAGVEMVLKDL

Gene3D: G3DSA:3.90.1150.10
IPR015422
9-63 no description
Pyridoxal phosphate-dependent transferase, major r

TEIVKRAWKRYNLSLGLGLNKVAGKVFIIRHLGNLNELQLLGCLAGVEMVLKDLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox