PRGDB00067732 (Can.4272)

From PRG Wiki
Jump to: navigation, search
Can.4272
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224690275 (GD078260)
Gene Class Unknown
Domain Type
Gene Species Capsicum annuum

Comment?

KS17030A01 KS17 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

CATATGTGATTGCTCTCTTTAGCTCTATGCTTTGGATATACTATGCATTTTTGAAGACCAATGTCACCCTACTCATAACAATAAACTCCTTTGGTATATTCATTGAAACTATCTACGTTGGTCTCTACCTTTTCTACGCACCGAAGAAAGCTAGGGTTCAAACTGGAAAGATGTTACTTTTAACAGTGGTGGGTGGATTTGGTGCAATAGTCTTGGTTACTCAATTTCTATTCAAAGGTGTTGTTCGTGGACAAGTAGTTGGATGGATTTGCCTTATTTTCGCCTTAAGTGTGTTTGTTGCACCCTTAGGCATTGTGAGAAAAGTCATCAAAACAAAGAGTGTGGAGTACATGCCATTACTCCTATCAGTATTCCTCACATTAAGTGCTGTTATGTGGTTCTTCTATGGTCTCCTACTAAAAGACATTAACATTGCTGCTCCAAATATATTGGGATTCATCTTTGGAGTACTCCAAATTGTGCTCTATGTAATATACAGCAAAAAGGAGAAGGCCATTCTAAAGGAACAGAAACTTCCAGAGATACAAAAGCCTGAAGTCATTGTAAGGGATGAGAACACAAATGATAATAAGAAGTTTCCAGAACTAACACGAGAACAAATTATTGACATAGTGAGGTTGGGTTTAATGATTTGCAAAGACAAAGTACACGTGGCAACATGTCCTCATGGTACTAAATGTGAAGCCAA


Protein sequences

Name Description Sequence
Can.4272 translated coding region predicted by ESTScan from UniGene Can.4272

XYVIALFSSMLWIYYAFLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKARVQTGKMLLLTVVGGFGAIVLVTQFLFKGVVRGQVVGWICLIFALSVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNILGFIFGVLQIVLYVIYSKKEKAILKEQKLPEIQKPEVIVRDENTNDNKKFPELTREQIIDIVRLGLMICKDKVHVATCPHGTKCEAX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
2-197 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

YVIALFSSMLWIYYAFLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKARVQTGKMLLLTVVGGFGAIVLVTQFLFKGVVRGQVVGWICLIFALSVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNILGFIFGVLQIVLYVIYSKKEKAILKEQKLPEIQKPEVIVRDENTNDN

HMMPfam: PF03083
IPR004316
2-51 MtN3_slv
RAG1-activating protein-1-related

YVIALFSSMLWIYYAFLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKA

HMMPfam: PF03083
IPR004316
85-171 MtN3_slv
RAG1-activating protein-1-related

QVVGWICLIFALSVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNILGFIFGVLQIVLYVIYSKKEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox