PRGDB00067736 (Can.4825)

From PRG Wiki
Jump to: navigation, search
Can.4825
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224668517 (GD099770)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

KS21006L01 KS21 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGGGAGCTTCACTTTCAGAGAAATGAGCTTGGCTACTAAGAACTTTGATAGCTCAAATCAAGTTGGTGAAGGAGGATATGGGACTGTCTTCAAGGGAATTTTAACTGACAAAACAGTTGTTGCTATTAAACGAGCAAAAGAAGGATCAGTACAAGGGCAAAAGGAATTTTTGACTGAGATATCCTTGTTATCAAGGTTACATCACCGGAATCTAGTGTCATTGTTAGGATACTGTGATGAAGAAGGAGAACAGATGCTAGTTTATGAATTCATGTGCAATGGAACTTTGCGAAACTGGATTCCTGTTAATAGTAAAGGAACTTTGGCGTTTGGAGCAAGATTGCAGATTGCATTAGGTGCAGCAAAGGGCATTCTTTACCTCCATACAGAAGCTCATCCACCTATATTCCATAGGGACATCAAAGCCAGCAATATTCTTCTTGACTCAAAAATGACAGCTAAAGTTGCTGATTTTGGATTGTCTAGGCTTGCACCTGTCCAGGATGATGAAGGTGTTCTACCTAATCATGTTTCAACTATTGTGAAGGGAACACCTGGTTACCTTGATCCCGAATATTTCTTGACCCGTAAATTGACAGATAAAAGTGATGTCTATAGCTTGGGAGTTGTGTTTCTAGAAATCTTAACTGGAATGCGTCCAATCTCACA


Protein sequences

Name Description Sequence
Can.4825 translated coding region predicted by ESTScan from UniGene Can.4825

XHEGSFTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
4-223 Protein kinase-like (PK-like)
Protein kinase-like domain

GSFTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRP

Gene3D: G3DSA:3.30.200.20
5-79 no description

SFTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLG

HMMPanther: PTHR24420:SF772
6-225 SUBFAMILY NOT NAMED

FTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPIS

HMMPanther: PTHR24420
6-225 FAMILY NOT NAMED,FAMILY NOT NAMED

FTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPIS

ProfileScan: PS50011
IPR000719
18-226 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISX

HMMSmart: SM00219
IPR020635
18-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPISX

HMMSmart: SM00220
IPR002290
18-225 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPIS

HMMPfam: PF07714
IPR001245
21-223 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTEISLLSRLHHRNLVSLLGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRP

PatternScan: PS00107
IPR017441
24-46 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGGYGTVFKGILTDKTVVAIK

Gene3D: G3DSA:1.10.510.10
80-224 no description

YCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRPI

PatternScan: PS00108
IPR008271
138-150 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IFHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox