PRGDB00067737 (Can.4912)

From PRG Wiki
Jump to: navigation, search
Can.4912
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224640894 (GD059149)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

KS14018H09 KS14 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGCCTCTTCTTTCTCTCTTCTTATTCCTCAAACACTCCACTTTTCTTCATTACAATACTTACCTAATTCTTGTTTATGGGTTTTCTTTCATGCAATGTCGAATCTGCTATTGCCACTTGCGATTCTTATAACTTTAAGAAGAATCGTAAAACACATAACCATACCCAAAGGTCATTCAAAATCACTGAGTTTTCTTACTCTGATCTCCACGCTGCTACGAATGCATTTTCTCGAGACAATCTTCTTGGTAAAGGAAGTCACGGTTACGTATACAAAGCTCATTTACATCAGTACAAGCTCATTGCTGCTGTCAAGAAAAGCAAATTAGCTGAACCCCCACGTCATAGTTCTAGTAATTTCCCAGCTGAAAATGAGATCGAAATCCTCTCTCGAGTGTATCATCCTCGGTTAGTTAACTTGCTGGGATATGCAGTTGATTCAAAACAGAATAAACTGATTGTTGTTGAGTTTATGCCTAATGGTTCTTTGTACGAATTGCTTCATTCTGATTCTAAGCCTCCTAGTTGGACCCGGCGTGTCCGATTTGCGCTGCAGATTGCGAGGGGCGTGCATTTTTTGCACTGTTCGAATCCACCTGTGATTCATAGGGACATTAAATCATCCAATATTCTCATCGACGGGAACTTCAGTGCTCGTGTTGGTGATTTTGGATTGTCATTGAGAGGAAATGTTGAAGATGTGGTTGTTAAAAGTACGCCACCTGCGGGTACTTTAGGGTACCTGGATCCT


Protein sequences

Name Description Sequence
Can.4912 translated coding region predicted by ESTScan from UniGene Can.4912

MGFLSCNVESAIATCDSYNFKKNRKTHNHTQRSFKITEFSYSDLHAATNAFSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
19-117 no description

NFKKNRKTHNHTQRSFKITEFSYSDLHAATNAFSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLG

superfamily: SSF56112
IPR011009
23-225 Protein kinase-like (PK-like)
Protein kinase-like domain

NRKTHNHTQRSFKITEFSYSDLHAATNAFSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

HMMPanther: PTHR24420:SF439
35-225 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KITEFSYSDLHAATNAFSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

HMMPanther: PTHR24420
35-225 FAMILY NOT NAMED,FAMILY NOT NAMED

KITEFSYSDLHAATNAFSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

ProfileScan: PS50011
IPR000719
51-225 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

HMMSmart: SM00220
IPR002290
51-223 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYL

HMMSmart: SM00219
IPR020635
51-223 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSRDNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYL

HMMPfam: PF00069
IPR017442
54-223 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DNLLGKGSHGYVYKAHLHQYKLIAAVKKSKLAEPPRHSSSNFPAENEIEILSRVYHPRLVNLLGYAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYL

PatternScan: PS00107
IPR017441
57-81 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSHGYVYKAHLHQYKLIAAVKK

Gene3D: G3DSA:1.10.510.10
118-225 no description

YAVDSKQNKLIVVEFMPNGSLYELLHSDSKPPSWTRRVRFALQIARGVHFLHCSNPPVIHRDIKSSNILIDGNFSARVGDFGLSLRGNVEDVVVKSTPPAGTLGYLDP

PatternScan: PS00108
IPR008271
175-187 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox