PRGDB00067741 (Can.5853)

From PRG Wiki
Jump to: navigation, search
Can.5853
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224677475 (GD134350)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Capsicum annuum

Comment?

KS26051E06 KS26 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGTGGTGTCTTGCCTTGGACGAGGCGTTTTAAGGTGGTTAAAGATTTAGCAGATTCTCTTGCATACCTTCATTCAAAACAACTTGCTCACAAGAATGTTAAAAGTAGCAGTGTTTTTCTTGACGTGAGCTTCAGAGCAGTAGTGGGTGATTTCGGGTTTGTGCTCACTTCAACCGGGTCGACCCGGTTTGAGTCCATGGTGAGTCAAACAGCTGACGTGTTCGAGTTCGGCGTAGCCGTGTTAGAGGTCATTGCGGGTCGGAGCAGGAAGTCCAACCCGGGTGAACGAGACTTGTTAGATCTTGCATGGGCAATGCATGAGGTACAACAGAAGGAAACTCTAGTGGATCGAAGAATGGGCGCGGTCGTGAACCTGGAGCAGGCTATTAGGGCTTTGGATATCGGGTTACTTTGTACACTAAACGAGAACAAAGGAAGGCCTACGATGGAAGAAGTAGTCGAGTTCCTGAATATGGAGAAACCAATACCCGAATTACCACCAGGTCGACCCGTTTGTTTGTTCCCGTACAGCAGCACCACAGGCTTGTGCAGTGGGTACGCTTGTACAGCATTCAAATGATGCAACGTGGTATGGTCGATCGACATAAAGTAGCCAATTAGTGCTTCGTATTCCACGTAAGGGGATATTATTCTGTCAGTTTGGGTACGAAATTATGACAGGGATAAGCACATGTATATGCTATGTGACGTTATTTTCA


Protein sequences

Name Description Sequence
Can.5853 translated coding region predicted by ESTScan from UniGene Can.5853

ARGGVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESMVSQTADVFEFGVAVLEVIAGRSRKSNPGERDLLDLAWAMHEVQQKETLVDRRMGAVVNLEQAIRALDIGLLCTLNENKGRPTMEEVVEFLNMEKPIPELPPGRPVCLFPYSSTTGLCSGYACTAFK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-158 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ARGGVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESMVSQTADVFEFGVAVLEVIAGRSRKSNPGERDLLDLAWAMHEVQQKETLVDRRMGAVVNLEQAIRALDIGLLCTLNENKGRPTMEEVVEFL

superfamily: SSF56112
IPR011009
2-187 Protein kinase-like (PK-like)
Protein kinase-like domain

RGGVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESMVSQTADVFEFGVAVLEVIAGRSRKSNPGERDLLDLAWAMHEVQQKETLVDRRMGAVVNLEQAIRALDIGLLCTLNENKGRPTMEEVVEFLNMEKPIPELPPGRPVCLFPYSSTTGLCSG

HMMPanther: PTHR24420
2-173 FAMILY NOT NAMED,FAMILY NOT NAMED

RGGVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESMVSQTADVFEFGVAVLEVIAGRSRKSNPGERDLLDLAWAMHEVQQKETLVDRRMGAVVNLEQAIRALDIGLLCTLNENKGRPTMEEVVEFLNMEKPIPELPPGRPV

Gene3D: G3DSA:1.10.510.10
4-162 no description

GVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESMVSQTADVFEFGVAVLEVIAGRSRKSNPGERDLLDLAWAMHEVQQKETLVDRRMGAVVNLEQAIRALDIGLLCTLNENKGRPTMEEVVEFLNMEK

HMMPfam: PF00069
IPR017442
4-68 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GVLPWTRRFKVVKDLADSLAYLHSKQLAHKNVKSSSVFLDVSFRAVVGDFGFVLTSTGSTRFESM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox