PRGDB00067742 (Can.5911)

From PRG Wiki
Jump to: navigation, search
Can.5911
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224659878 (GD061056)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

KS14039F04 KS14 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGCCGAGAAGGGACTTCAGGTTTTCACATTTAAGCAGCTGCATTCAGCCACTGGCGGGTTTGGAAAATCTAATGTCATTGGCCATGGTGCTTTCGGGTCAGTGTACAGAGGAGTGCTTCAAGATGGGCGGAAGGTTGCGATTAAGCTGATGGATCAAGCTGGAAAACAAGGGGAGGAAGAATTCAAAGTGGAGGTGGAGTTGCTGTGCCTCTTGCGCTCACCATATTTGCTGTCATTGATTGGCTATTGTTCAGAAAGCAGCCATAAATTGCTTGTTTATGAATTCATGGCAAATGGTGGTTTGCAGGAGCACTTGTATCCAATCAAAGGTTCCAGTAATTTTTGTCCAAAGTTGGACTGGAAGACTCGATTGAGAATAGCTTTGGAGGCTGCTAAAGGTCTGGAATATCTCCATGAGCATGTCAATCCGCCAGTTATTCATAGAGATCTTAAGAGTAGCAATATACTTTTGGACAAAAATTTCCATGCCAAAGTTTCTGACTTTGGATTGGCCAAGCTTGGATCTGATAAAGCTGGCGGGCATGTCTCTACCCGAGTTTTGGGGACACAAGGATATGTTGCTCCAGAATATGCATTAACAGGACACTTGACTACCAAATCAGATGTTTACAGTTATGGGGTTGTCCTCCTAGAGTTGTTGACGG


Protein sequences

Name Description Sequence
Can.5911 translated coding region predicted by ESTScan from UniGene Can.5911

XHEAEKGLQVFTFKQLHSATGGFGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
4-85 no description

AEKGLQVFTFKQLHSATGGFGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGY

HMMPanther: PTHR24420:SF882
5-224 SUBFAMILY NOT NAMED

EKGLQVFTFKQLHSATGGFGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLT

HMMPanther: PTHR24420
5-224 FAMILY NOT NAMED,FAMILY NOT NAMED

EKGLQVFTFKQLHSATGGFGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLT

superfamily: SSF56112
IPR011009
9-224 Protein kinase-like (PK-like)
Protein kinase-like domain

QVFTFKQLHSATGGFGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLT

ProfileScan: PS50011
IPR000719
23-225 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTX

HMMSmart: SM00219
IPR020635
23-225 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTX

HMMSmart: SM00220
IPR002290
23-225 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGKSNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTX

HMMPfam: PF00069
IPR017442
26-224 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNVIGHGAFGSVYRGVLQDGRKVAIKLMDQAGKQGEEEFKVEVELLCLLRSPYLLSLIGYCSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLT

PatternScan: PS00107
IPR017441
29-51 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGAFGSVYRGVLQDGRKVAIK

Seg: seg
70-82 seg

LLCLLRSPYLLSL

Gene3D: G3DSA:1.10.510.10
86-224 no description

CSESSHKLLVYEFMANGGLQEHLYPIKGSSNFCPKLDWKTRLRIALEAAKGLEYLHEHVNPPVIHRDLKSSNILLDKNFHAKVSDFGLAKLGSDKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLT

PatternScan: PS00108
IPR008271
148-160 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox