PRGDB00067745 (Can.6776)

From PRG Wiki
Jump to: navigation, search
Can.6776
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224669189 (GD120264)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

KS24025H12 KS24 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGGTTGTTGTCAATCTTCAATCTTGGGTGAACTTAGTTCAGAAAAAGATCAGCAACGTCATGGAGTTGGTGGGGCCCATACAAGAGCTTCAAATGGCACCGGCGCCGGAGCAGCCATCGGAGATGGTGGAGTTCCGGTGTTCTCAGAGTTTTCATTATCTGAGCTAAAAGCAGCTACCAATAACTTTAGTTCAGAGTTTATAGTATCTGAAAGTGGTGAAAAAGCACCTAATATGGTGTATAAAGGGCGTTTGCAGAATCGGAGGTGGATAGCTGTAAAGAAATTTACTAAATCTGCTTGGCCTGATCCTAAACAGTTTGCGGATGAAGCATCAGGTGTTGGGAAATTGAGGCATAAAAGGCTGGCTAATTTGATTGGGTACTGTTCTGATGGGGACGAGAGGCTGCTTGTAGCTGAGTACATGCCAAATGATACACTTGCAAAGCATCTGTTTCACTGGGAGAATCAAACGCTTGAGTGGGCAATGCGGTTAAGAGTGGCTCTCTATATCGCTGAAGCATTGGATTACTGTAGCACTGAAGGTCGTCCACTATATCATGACTTGAACGCGTATCGAGTTCTCTTCGACGAGAGTGGCGATCCCCGTCTTTCT


Protein sequences

Name Description Sequence
Can.6776 translated coding region predicted by ESTScan from UniGene Can.6776

XHEGCCQSSILGELSSEKDQQRHGVGGAHTRASNGTGAGAAIGDGGVPVFSEFSLSELKAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRLS

Domains

Domain Start-End Description Sequence

Seg: seg
35-46 seg

GTGAGAAIGDGG

HMMPanther: PTHR24420:SF885
47-207 SUBFAMILY NOT NAMED

VPVFSEFSLSELKAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRLS

HMMPanther: PTHR24420
47-207 FAMILY NOT NAMED,FAMILY NOT NAMED

VPVFSEFSLSELKAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRLS

superfamily: SSF56112
IPR011009
50-207 Protein kinase-like (PK-like)
Protein kinase-like domain

FSEFSLSELKAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRLS

Gene3D: G3DSA:3.30.200.20
51-130 no description

SEFSLSELKAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGY

ProfileScan: PS50011
IPR000719
68-207 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRLS

HMMPfam: PF07714
IPR001245
81-201 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

MVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGKLRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDES

Gene3D: G3DSA:1.10.510.10
131-206 no description

CSDGDERLLVAEYMPNDTLAKHLFHWENQTLEWAMRLRVALYIAEALDYCSTEGRPLYHDLNAYRVLFDESGDPRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox