PRGDB00067746 (Can.6922)

From PRG Wiki
Jump to: navigation, search
Can.6922
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224621284 (GD058327)
Gene Class Unknown
Domain Type LRR
Gene Species Capsicum annuum

Comment?

KS14010A07 KS14 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGTTTTCTACTTTTTGAAAACAATGCTAGTGGATTGAGCGAACTTGATATGTTAAAGCGGTTGGAAAAGCTGAAGATAGTGAATGATGATCAAAATTTGGAAAAGTTGAAGATGGTGAATGATGATCAAGATTTGGAAAAGTCGAAGATAGTGTATGATGATCAAGATGACAGTCAAGTTATGACTCCTCCTGTGATGGTATTTATGCTTCCCAATACCCTGAGGAAGTTGACCTTGTATAATACCCGATTGAATTGGCGGGATATGACCAAATTGGGGCCGCTCGAGTCCCTTGAAGTCCTTAAGTTGAGGGAGAATGCTTTCAGTGGGGAGTTCTGGGAGCCAGAAATTGGCAGCTTCGCTAGACTAGAAGTATTGTGGATTGAGAAGACAGACTTGCAAATCTGGAAGGCTTCAAGTCACAACTTCCCCCGCCTTAAGCAGCTTGTTCTTATATTATGTGAGGAACTTGAAGAAGTTCCACAAGGCCTGGCTGACATACCCAATCTCCAAGAGATTCGACTGGAATGTACGTACAAAGCAGTCAAATCAGCAAGCATTATAGCCAAGAAGAAGCTGGAAGACCATGCTAGCTCTAGCGTCTCCAGGTTCAGACTCTCAGTATTTCCTCCCCACTTGGATGCTGATGATTCTAGTTAAAACAACAGGCAGACGTCGTTATGCTTCACTTTGGTTGTGAGCTAATGTCCTCTTTG


Protein sequences

Name Description Sequence
Can.6922 translated coding region predicted by ESTScan from UniGene Can.6922

ARGFLLFENNASGLSELDMLKRLEKLKIVNDDQNLEKLKMVNDDQDLEKSKIVYDDQDDSQVMTPPVMVFMLPNTLRKLTLYNTRLNWRDMTKLGPLESLEVLKLRENAFSGEFWEPEIGSFARLEVLWIEKTDLQIWKASSHNFPRLKQLVLILCEELEEVPQGLADIPNLQEIRLECTYKAVKSASIIAKKKLEDHASSSVSRFRLSVFPPHLDADDSS

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
15-177 L domain-like,LRR

SELDMLKRLEKLKIVNDDQNLEKLKMVNDDQDLEKSKIVYDDQDDSQVMTPPVMVFMLPNTLRKLTLYNTRLNWRDMTKLGPLESLEVLKLRENAFSGEFWEPEIGSFARLEVLWIEKTDLQIWKASSHNFPRLKQLVLILCEELEEVPQGLADIPNLQEIRL

Gene3D: G3DSA:3.80.10.10
63-179 no description

MTPPVMVFMLPNTLRKLTLYNTRLNWRDMTKLGPLESLEVLKLRENAFSGEFWEPEIGSFARLEVLWIEKTDLQIWKASSHNFPRLKQLVLILCEELEEVPQGLADIPNLQEIRLEC

Seg: seg
151-162 seg

LVLILCEELEEV

Seg: seg
182-194 seg

KAVKSASIIAKKK

Seg: seg
200-211 seg

SSSVSRFRLSVF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox