PRGDB00067747 (Can.7169)

From PRG Wiki
Jump to: navigation, search
Can.7169
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 282803097 (GO345515)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

CS01007A03 Hotpepper under oxidative stress Capsicum annuum cDNA 5', mRNA sequence

DNA Sequence

GCACGAGGAGATTGCAGATTTTAACCTGTCAAACCAGGCTCCTGACATGGCTGCTCGCCTTCATTCTACTCGAGTTTTAGGAACATTTGGCTATCATGCACCAGAATACGCTATGACTGGACAACTGACACAGAAGAGTGATGTCTATAGCTTTGGAGTTGTCTTGCTTGAACTTTTGACTGGAAGAAAACCTGTAGATCATACAATGCCTCGAGGACAGCAGAGCCTGGTTACTTGGGCTACCCCGAGACTGAGTGAAGACAAAGTCCAGCAATGTGTTGATCCAAAGCTGAAAGGATGTCCTCCAAAAGCAGTGGCTAAGATGGCAGCGGTGGCAGCACTGTGCGTGCAATACGAGGCTGAATTCCGTCCAAATATGAGTATTGTAGTCAAAGCTCTCCAACCACTACTGAGGGCACCTGCTGCACCTGCTCCAGAAGTATAGGGAGCCGATCATCGCTCGCTTGTTCTGGAATTTCTACATGCTAATTTGTAACTGTTTTGGTATATCATCCCAGTATTTCATTTGTGACGTGATTTCGaaaaaacaaaaaacaaacagagacttcaattttttttCCCCTTTATTGAAACTGGTGTGTAGGATTTGATTGATTGCTTAACTTACATGGTGAGATTGTTTGAGGATTTCCCTGAGAACTGAGGGGTGTCTATATTTATTTATTTTTCCCTGAA


Protein sequences

Name Description Sequence
Can.7169 translated coding region predicted by ESTScan from UniGene Can.7169

XHEEIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAPAAPAPEV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-138 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHEEIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
4-134 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKAL

superfamily: SSF56112
IPR011009
5-134 Protein kinase-like (PK-like)
Protein kinase-like domain

IADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKAL

Gene3D: G3DSA:1.10.510.10
5-133 no description

IADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKA

HMMPanther: PTHR24420:SF416
5-148 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAPAAPAPEV

HMMPanther: PTHR24420
5-148 FAMILY NOT NAMED,FAMILY NOT NAMED

IADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKGCPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAPAAPAPEV

Seg: seg
104-114 seg

KAVAKMAAVAA

Seg: seg
133-146 seg

ALQPLLRAPAAPAP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox