PRGDB00067749 (Can.7737)

From PRG Wiki
Jump to: navigation, search
Can.7737
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224633297 (GD099304)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

KS21001J07 KS21 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGGCTTAAGGTACTCGGTCACGGTAACGGTGGAACTGTATACAAAGTCCGTCACAAGCGGACTTCGGCAATCTACGCACTCAAAGTCGTTCACGGTGATAGTGACCCGGAGATTCGCCGTCAGATCCTCCGTGAAATCTCAATACTTCGCCGGACGGATTCACCTTACGTCATCAAGTGTCATGGAGTCATTGATATGCCTGGAGGAGACATTGGTATACTCATGGAGTATATGAATTCCGGCACTCTAGAAAATCTTCTTAAATCACAAACAACTTTCTCCGAACTTTGCTTAGCTAAAATCGCTAAGCAAGTACTAAGTGGATTAGACTACTTGCACAACCACAAAATCATTCACAGAGATCTAAAGCCTTCGAACCTTCTAGTTAACCGAGAAATGGAGGTGAAAATCGCCGATTTCGGAGTTAGCAAAATCATGTGCAGAACTTTGGATCCTTGCAATTCATACGTTGGAACTTGCGCTTATATGAGTCCAGAAAGGTTTGATCCGGACACTTATGGAGTCAACTACAATGGCTACGCAGCTGATATTTGGAGTTTAGGTCTTACATTAATGGAACTATACATGGGCCACTTTCCATTCTTACCACCAGGCCAACGACCGGATTGGGCAACACTGATGTGCGCTATATGCTTCGGTGAACCACCCAGCTTGCCCAAGGTACATCGGAGAAATCAAAGATTTCATGGAGTGTTGC


Protein sequences

Name Description Sequence
Can.7737 translated coding region predicted by ESTScan from UniGene Can.7737

ARGLKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLPKVHRRNQRFHGVLX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-242 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ARGLKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLPKVHRRNQRFHGVLX

HMMSmart: SM00219
IPR020635
1-237 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ARGLKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLPKVHRRNQRF

HMMSmart: SM00220
IPR002290
1-241 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ARGLKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLPKVHRRNQRFHGVL

HMMPfam: PF00069
IPR017442
4-206 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPP

Gene3D: G3DSA:3.30.200.20
4-107 no description

LKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQV

HMMPanther: PTHR24361:SF31
4-228 SUBFAMILY NOT NAMED

LKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLP

HMMPanther: PTHR24361
4-228 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

LKVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPSLP

superfamily: SSF56112
IPR011009
5-203 Protein kinase-like (PK-like)
Protein kinase-like domain

KVLGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTDSPYVIKCHGVIDMPGGDIGILMEYMNSGTLENLLKSQTTFSELCLAKIAKQVLSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPF

PatternScan: PS00107
IPR017441
7-30 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGNGGTVYKVRHKRTSAIYALK

FPrintScan: PR00109
IPR001245
77-90 TYRKINASE
Serine-threonine/tyrosine-protein kinase

MEYMNSGTLENLLK

Gene3D: G3DSA:1.10.510.10
108-205 no description

LSGLDYLHNHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMCRTLDPCNSYVGTCAYMSPERFDPDTYGVNYNGYAADIWSLGLTLMELYMGHFPFLP

FPrintScan: PR00109
IPR001245
113-131 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHNHKIIHRDLKPSNLLV

PatternScan: PS00108
IPR008271
119-131 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPSNLLV

FPrintScan: PR00109
IPR001245
184-206 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADIWSLGLTLMELYMGHFPFLPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox