PRGDB00067750 (Can.7750)

From PRG Wiki
Jump to: navigation, search
Can.7750
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224643899 (GD060283)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Capsicum annuum

Comment?

KS14031C07 KS14 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GGACTGCAACTGATCATTTCAGCTCCAAAAATATTTTGGGTAGCGGAGGATTTGGAGTTGTGTACAAGGGCCGCTTAAATAATGGAACTGTTGTGGCTGTCAAAAGATTGAAGGACTACAATGCTGTTGGTGGTGAAATCCAATTTCAGACAGAAGTCGAGTTAATTAGTTTGGCTGTCCATCGAAATCTTCTCCGTCTTTGGGGTTTTTGTTCAACTGAAAGTGAAAGGCTTCTTGTTTACCCCTATATGCCAAATGGAAGTGTGGCTGCACGATTAAAAGATCACATCCATGGCAGACCAGTTTTGGACTGGTCAAGGCGGAAAGGAATAGCATTAGGTACAGCAAGAGGGCTAGTATATTTGCATGAGCAGTGTGACCCCAAAATTATCCATCGGGATGTCAAAGCAGCTAACATTCTGTTGGATGAGGAATTTGAAGCAGTTGTTGGAGATTTTGGGTTGGCCAAGCTCTTGGATCACCGGGATTCTCATGTAACTACTGCTGTCAGGGGCACAGTTGGTCACATTGCTCCAGAATATTTGTCAACGGGTCAATCGTCAGAGAAGACTGATGTGTTTGGGTTTGGAATCTTGCTTCTTGAGCTAATTACTGGTCAGAAAGCTGTGGACTTTGGACGAGGGGCCAACCAGAAAGGTGTCATGCTTGATTGGGTAAAGAAGCTTCAT


Protein sequences

Name Description Sequence
Can.7750 translated coding region predicted by ESTScan from UniGene Can.7750

XTATDHFSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKLH

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-211 Protein kinase-like (PK-like)
Protein kinase-like domain

TATDHFSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVD

Gene3D: G3DSA:3.30.200.20
2-72 no description

TATDHFSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCS

HMMPanther: PTHR24420:SF851
3-230 SUBFAMILY NOT NAMED

ATDHFSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKLH

HMMPanther: PTHR24420
3-230 FAMILY NOT NAMED,FAMILY NOT NAMED

ATDHFSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKLH

ProfileScan: PS50011
IPR000719
7-230 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKLH

HMMSmart: SM00220
IPR002290
7-226 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWV

HMMSmart: SM00219
IPR020635
7-229 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKL

HMMPfam: PF00069
IPR017442
9-213 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SKNILGSGGFGVVYKGRLNNGTVVAVKRLKDYNAVGGEIQFQTEVELISLAVHRNLLRLWGFCSTESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFG

PatternScan: PS00107
IPR017441
13-35 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGGFGVVYKGRLNNGTVVAVK

Gene3D: G3DSA:1.10.510.10
73-210 no description

TESERLLVYPYMPNGSVAARLKDHIHGRPVLDWSRRKGIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox