PRGDB00067754 (Can.8918)

From PRG Wiki
Jump to: navigation, search
Can.8918
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224674213 (GD070369)
Gene Class N
Domain Type NBS
Gene Species Capsicum annuum

Comment?

KS16010D06 KS16 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GCACGAGGGTTAGTTTATGAAAACATGGGAGATTGTCTTATATATAGTAATGACCCAAGAACCTATGTCGGGCTTATAAAAATGAGTTACGATCTGCTGTCTTATTACCAACAGGCGTGTTTCCTGTATTGTGCTAGCTTTCCTCAAAGTTTTAATATCCCTGCTTGGAAATTGATCCATTTGTGGATCGCAGAAGGTTTCATACCAATTCAGAAGCAATTTACCCTGGAGGAACAAGCAGAAGAATGTCTGAATGATCTTACTAAGAAGAACTTACTGATGGTAATAGAGCAGTCATTAGATGGAAAGATCAAGACATGTCGTCTTAACGACATGTTCTATGAGTTTTGCGAGAAGGAAGCAATTGAGGAAGACATTGTCTGGGCGATTAAAAACGCACCTGATCAGGAGTCTTTGGAGACGAAAGATTTAGGCACATGTCGACGCCTTTGCATTGATTCTTCCACTTTGAGTAATTTCCTCAAGGAACTTCGTAAGAAACCGCCTATGGAGAATGTCAAGTCTTTCTTTTGTTTTAGCTCAAAACCAATTGACAACCAAACTCCAGACATGAATAAATCCTTGCACAAGGGCTTTCCCCTGATTAAAGTCCTCGATGTTGAACCCATAAGATCTCTCTTCTCGAAGGATTTTTATCGGTTGTTGCATTTGAAATACATTTCACTCTCAGGAGAATTCAAGTCCCTTCCACTAATGTTTGTCAAGTTC


Protein sequences

Name Description Sequence
Can.8918 translated coding region predicted by ESTScan from UniGene Can.8918

MSYDLLSYYQQACFLYCASFPQSFNIPAWKLIHLWIAEGFIPIQKQFTLEEQAEECLNDLTKKNLLMVIEQSLDGKIKTCRLNDMFYEFCEKEAIEEDIVWAIKNAPDQESLETKDLGTCRRLCIDSSTLSNFLKELRKKPPMENVKSFFCFSSKPIDNQTPDMNKSLHKGFPLIKVLDVEPIRSLFSKDFYRLLHLKYISLSGEFKSLPLMFVKF

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-44 NB-ARC,NBS
NB-ARC

MSYDLLSYYQQACFLYCASFPQSFNIPAWKLIHLWIAEGFIPIQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox