PRGDB00067755 (Can.9046)

From PRG Wiki
Jump to: navigation, search
Can.9046
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 282803085 (GO345503)
Gene Class Unknown
Domain Type LRR
Gene Species Capsicum annuum

Comment?

CS01020F05 Hotpepper under oxidative stress Capsicum annuum cDNA 5', mRNA sequence

DNA Sequence

GCACGAGGGTAAAAGCAGAAATATGGAACATGTTACAGCTGCGGCATCTGCACACCAACATACCTGCAAAATTGCCATCACCTACTACCACAACAGGTAAAGCTTCTTGTCTACAAACTCTTTCTATGGTTTCACCAGAAAGTTGCAAGAAAGATGTGCTCGCTAAGGCGTGTAATCTAAAAAAGTTGGGTATTCGAGGTCAAATGGCGGTTTTTCTTGAAACCAGAGGTGGAATCAGCAATCTTGAAGAGTTAAAGTGCCTGGAACATCTGAAACTGTTGAATGATGCTCTTTACATGAATAAATCGCTTCATCTCCCTCCAGCATTCTTTAGACTTGTACGTACAGTGAAGAAGTTAACTTTGGCTAACACAAAGTTTCCATGGAGTGAGGCGGATAGATTAGGGCAATTGGAATCCCTTGAGGTTCTAAAGTTGAAAGAAAATGCATTCATGGGTGATACTTGGAGGCCGGAGGTAGGAGGTTTTAGCCAGCTCCAGGTATTGTGGATAGAGAGGGCAGAATTAGAAACTTGGGAAGCGTCGAATCTTTGCTTCCCCATCCTTAGTCACCTTGTTCTTGTCTCCTGTGATAAGCTCAACGCTGTGCCACTTGAGCTGGCTGATATACCTAATCTTCACGAGATGAAGCTGGATAATACAAGCAAAGCGGTCAAATCTGCAAAAGAAATACTGAAACGTAAGACATCCAAAAACATAAAATTCAAGTTCAGCATGTTCCCTCCCGAAACTGAATC


Protein sequences

Name Description Sequence
Can.9046 translated coding region predicted by ESTScan from UniGene Can.9046

XTRVKAEIWNMLQLRHLHTNIPAKLPSPTTTTGKASCLQTLSMVSPESCKKDVLAKACNLKKLGIRGQMAVFLETRGGISNLEELKCLEHLKLLNDALYMNKSLHLPPAFFRLVRTVKKLTLANTKFPWSEADRLGQLESLEVLKLKENAFMGDTWRPEVGGFSQLQVLWIERAELETWEASNLCFPILSHLVLVSCDKLNAVPLELADIPNLHEMKLDNTSKAVKSAKEILKRKTSKNIKFKFSMFPPETES

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
8-220 L domain-like,LRR

IWNMLQLRHLHTNIPAKLPSPTTTTGKASCLQTLSMVSPESCKKDVLAKACNLKKLGIRGQMAVFLETRGGISNLEELKCLEHLKLLNDALYMNKSLHLPPAFFRLVRTVKKLTLANTKFPWSEADRLGQLESLEVLKLKENAFMGDTWRPEVGGFSQLQVLWIERAELETWEASNLCFPILSHLVLVSCDKLNAVPLELADIPNLHEMKLDN

Gene3D: G3DSA:3.80.10.10
10-222 no description

NMLQLRHLHTNIPAKLPSPTTTTGKASCLQTLSMVSPESCKKDVLAKACNLKKLGIRGQMAVFLETRGGISNLEELKCLEHLKLLNDALYMNKSLHLPPAFFRLVRTVKKLTLANTKFPWSEADRLGQLESLEVLKLKENAFMGDTWRPEVGGFSQLQVLWIERAELETWEASNLCFPILSHLVLVSCDKLNAVPLELADIPNLHEMKLDNTS

Seg: seg
82-94 seg

LEELKCLEHLKLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox