PRGDB00067781 (Can.13318)

From PRG Wiki
Jump to: navigation, search
Can.13318
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224696676 (GD055294)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Capsicum annuum

Comment?

KS13040H07 KS13 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GGGGTGTGATATTGGATTGGAGGAAGAGATTTGAAATTATAGAGGGAATTGCTAAAGGACTTCTTTATCTACATCATGACTCGAGATTAAGAATCATTCATAGAGATCTGAAAACAAGTAATATATTGTTAGATGAAGAGTTGAATCCAAAAATATCAGATTTTGGATTAGCAAGAGTTGTTGAAGGGAAAATTACACAAGCAAATACAAATAAAGTGGTTGGAACATATGGTTATATGGCTCCGGAGTATGCGATTGATGGATTATTCTCAATCAAATCGGATGTATTTAGTTTTGGAATAGTCATACTCGAGATCATCAGTGGAAGAAGGAACACCGGATTTTTTCATCAAGAAGAAGAGTCGAACCTCTTAGGCCATGCATGGAGATTATGGACTGAAGATAGAGCAATGGACTTGGTGGATCAATCACTACATGAATCATGCAACAAAGAAGAAGCAATTAAATGTCTAAATATTGGACTTTTGTGTGTACAAGAAGATCCAAAAGATAGACCAAATACATCAAGCATAATAATGATGCTTGGCAGTGAAAATATTGTTTCACTTCCAAGACCAAATCAGCCAGCCTTCATGACAAGAAAATGTGGTGGTGGTAACACATCTTCTTCTTCTAATGTTAAGTCTGATGGTGTCTCTAATAATCAGCTTACTGTCACCATTGAAATGGGTCGATAACGCACTACTAGAAATCAGTCAAT


Protein sequences

Name Description Sequence
Can.13318 translated coding region predicted by ESTScan from UniGene Can.13318

XGVILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMMLGSENIVSLPRPNQPAFMTRKCGGGNTSSSSNVKSDGVSNNQLTVTIEMGRXRTTRNQSX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-198 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGVILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMMLGSENIVSLPRPNQPAF

HMMSmart: SM00219
IPR020635
2-182 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GVILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMML

HMMSmart: SM00220
IPR002290
3-182 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMML

HMMPanther: PTHR24420:SF703
4-234 SUBFAMILY NOT NAMED

ILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMMLGSENIVSLPRPNQPAFMTRKCGGGNTSSSSNVKSDGVSNNQLTVTIEMGRXR

HMMPanther: PTHR24420
4-234 FAMILY NOT NAMED,FAMILY NOT NAMED

ILDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMMLGSENIVSLPRPNQPAFMTRKCGGGNTSSSSNVKSDGVSNNQLTVTIEMGRXR

superfamily: SSF56112
IPR011009
5-182 Protein kinase-like (PK-like)
Protein kinase-like domain

LDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIMML

HMMPfam: PF00069
IPR017442
5-178 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSI

Gene3D: G3DSA:1.10.510.10
5-180 no description

LDWRKRFEIIEGIAKGLLYLHHDSRLRIIHRDLKTSNILLDEELNPKISDFGLARVVEGKITQANTNKVVGTYGYMAPEYAIDGLFSIKSDVFSFGIVILEIISGRRNTGFFHQEEESNLLGHAWRLWTEDRAMDLVDQSLHESCNKEEAIKCLNIGLLCVQEDPKDRPNTSSIIM

PatternScan: PS00108
IPR008271
32-44 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTSNILL

HMMPfam: PF11883
IPR021820
189-231 DUF3403
S-locus receptor kinase, C-terminal

SLPRPNQPAFMTRKCGGGNTSSSSNVKSDGVSNNQLTVTIEMG

Seg: seg
204-222 seg

GGGNTSSSSNVKSDGVSNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox