PRGDB00067816 (Can.21531)

From PRG Wiki
Jump to: navigation, search
Can.21531
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224693077 (GD103238)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Capsicum annuum

Comment?

KS21045I20 KS21 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

AAAGATTAGGCTTATCAGAGAAGAAGTCTCCAATTTACTTGAGAAGATTCCCAAGAACAGGAGTCGCCTTCTTGTAAACTCTCCCAAGAATCCAGTTGAAAGAAAATCATTGATGGGTGGTAAAATAATTGTAGGTTTTAAGGAGGAGACAAACTGGTTAATTAGGAAGCTCATCAGTGGACCGAAAGATCTAGATGTCATCTCAATCACTGGTATGCCGGGTTCGGGCAAAACTATCTAGATGTCATCTCAATCACTGGTATGCCGGGTTCGGGCAAAACTACTTTGGCGTACAAAATATACAATGATGAATCAGTTTGTAGTCATTTCGACATTCGTGCATGGTGCACAGTCAACCAAGAATATGACGAGAAGAAGTTGCTGGTGATACTTTTCAATCAAGTTACTGGCTCAGATTTGAAGTCCAGTGAGGGTATTGATGTTGCCGATAAGCTGAGGAAACAATTGTATGGAAAGAGGTATCTAATTGTGTTAGATGACGTGTGGGATACTGCTACATGGGATGATTTAACAAGACCTTTCCCTGAAGTTGAGAAAGGAAGTAGAATTATTTTAACGACTCGACAAAAGGAAGTGGCTTTTCATGGAAAGTGCAACACTGATCCTCTTAACCTTCGA


Protein sequences

Name Description Sequence
Can.21531 translated coding region predicted by ESTScan from UniGene Can.21531

XKIRLIREEVSNLLEKIPKNRSRLLVNSPKNPVERKSLMGGKIIVGFKEETNWLIRKLISGPKDLDVISITGMPXFGQNYLDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRIILTTRQKEVAFHGKCNTDPLNLR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-192 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IREEVSNLLEKIPKNRSRLLVNSPKNPVERKSLMGGKIIVGFKEETNWLIRKLISGPKDLDVISITGMPXFGQNYLDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRII

HMMPanther: PTHR23155
6-192 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IREEVSNLLEKIPKNRSRLLVNSPKNPVERKSLMGGKIIVGFKEETNWLIRKLISGPKDLDVISITGMPXFGQNYLDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRII

Gene3D: G3DSA:3.40.50.300
79-199 no description

NYLDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRIILTTRQKE

superfamily: SSF52540
79-203 P-loop containing nucleoside triphosphate hydrolases

NYLDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRIILTTRQKEVAFH

HMMPfam: PF00931
IPR002182
81-211 NB-ARC,NBS
NB-ARC

LDVISITGMPGSGKTTLAYKIYNDESVCSHFDIRAWCTVNQEYDEKKLLVILFNQVTGSDLKSSEGIDVADKLRKQLYGKRYLIVLDDVWDTATWDDLTRPFPEVEKGSRIILTTRQKEVAFHGKCNTDPL

FPrintScan: PR00364
IPR000767
83-98 DISEASERSIST
Disease resistance protein

VISITGMPGSGKTTLA

FPrintScan: PR00364
IPR000767
156-170 DISEASERSIST
Disease resistance protein

QLYGKRYLIVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox