PRGDB00067817 (Can.21695)

From PRG Wiki
Jump to: navigation, search
Can.21695
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224696576 (GD126581)
Gene Class NL
Domain Type NBS, LRR
Gene Species Capsicum annuum

Comment?

KS25030O12 KS25 Capsicum annuum cDNA, mRNA sequence

DNA Sequence

GAAATGCGCGCCTCCGTGTGGCAAGAGTTTGCAAAGGATTTAAGTTCCCTTGGTTTAGAAGAGCAGAGTATGAAGGCAGTTCAATCAAGTTATGACTATTTAGGGGATCATCTAAAGCATTGCCTTCTTTACATTGGATACTTTCCAGAAGACTATAGCATTCCGGTGTCCGATTTACTAAAGCTATGGATAGCTGAAGAGTTTGTACCGACCATTGACCCGGAGAACCTAGAAAAGTCATCCAAAGATTTCTTGTGCGATCTTGTCAGTAGAAGCCTCCTAATGGTTTCTAAAAGGCGATCTAATGGTGATATAAAATACTGCATGGTTCATGATCTAATTCGCGAGTTTTGCTCGAGTAAACTTAAAGAAGAAGAGTTTAAACAGCGTGTCATGCCACACAACTCATCCCAATCTTCATATCCAAAGGATCCTCGATTCTGCATGTACATCCATGACAATCTTGTTAATCAATTGGAGCAGCATGGATATTCACTGGATGAGATTCCAATGGTGGGCTCTGAAGAAAAAGAGTCTCTTGAGTTCATCGCTCATCCGCGATTCTATTCATCGAGATGTATGGATTTTTTCTCATTACTTATTAACTTGAGGTTTATAAGGGTGTTGCATTTGCTGGATGTCAATATGGAAAGTGCTTGGGAATTTAAAGCTCTACGGCTTCCAAACTAGGAAAACTCACT


Protein sequences

Name Description Sequence
Can.21695 translated coding region predicted by ESTScan from UniGene Can.21695

EMRASVWQEFAKDLSSLGLEEQSMKAVQSSYDYLGDHLKHCLLYIGYFPEDYSIPVSDLLKLWIAEEFVPTIDPENLEKSSKDFLCDLVSRSLLMVSKRRSNGDIKYCMVHDLIREFCSSKLKEEEFKQRVMPHNSSQSSYPKDPRFCMYIHDNLVNQLEQHGYSLDEIPMVGSEEKESLEFIAHPRFYSSRCMDFFSLLINLRFIRVLHLLDVNMESAWEFKALRLPNXENSL


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
11-72 NB-ARC,NBS
NB-ARC

AKDLSSLGLEEQSMKAVQSSYDYLGDHLKHCLLYIGYFPEDYSIPVSDLLKLWIAEEFVPTI

HMMPanther: PTHR11017
24-125 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MKAVQSSYDYLGDHLKHCLLYIGYFPEDYSIPVSDLLKLWIAEEFVPTIDPENLEKSSKDFLCDLVSRSLLMVSKRRSNGDIKYCMVHDLIREFCSSKLKEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox