PRGDB00067826 (Can.25891)

From PRG Wiki
Jump to: navigation, search
Can.25891
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224708771 (FJ705846)
Gene Class Unknown
Domain Type
Gene Species Capsicum annuum

Comment?

Capsicum annuum dihydroflavonol-4-reductase (DFR) mRNA, partial cds

DNA Sequence

ATGGCAAGTGAAGATCAAGCAGTTGTTGATGCACCATCTCCTCCAGTGGCGCCGACGGTTTGCGTCACTGGAGCGGCTGGATTTATCGGCTCTTGGCTTGTCATGAGACTCCTTGAACGTGGTTATAATGTCCATGCTACTGTTCGTGATCCTGAGAACAAAAAGAAGGTGAAACATCTGTTGGAATTGCCAGAAGCTGATACAAACTTAACGCTGTGGAAAGCAGACTTGACCGTGGAAGGAAGCTTTGATGAAGCCATTCAAGGCTGTCAAGGAGTATTCCATGTGGCTACCCCAATGGATTTCGAGTCCAAGGACCCTGAGAACGAAGTAATTAAACCAACGGTCAGGGGAATGTTAAGCATCATAGAATCATGTGCTAAAGCTAACACAGTGAAGAGGCTGGTTTTCACTTCATCGGCTGGAACTCTTGATGTCCAAGAGCACCAAAAAATCTTCTATGATGAGACCAGCTGGAGCGATTTGGACTTCATATATGCTAAGAAGATGACAGGATGGATGTATTTTGTTTCCAAGATACTGGCAGAGAAGGCTGCAATGGAAGAAGCTAAAAAGAATAACATTGATTTCATTAGCATCATACCACCACTGGTTGTTGGTCCATTCATCACACCTACGTTCCCACCTAGCTTAATCACTGCCCTTTCACTAATTACTGGTAATGAAGCTCACTACTGCATCATTAAACAAGGTCAATATGTGCATTTGGATGATCTTTGTGAGGCTCAT


Protein sequences

Name Description Sequence
Can.25891 translated coding region predicted by ESTScan from UniGene Can.25891

MASEDQAVVDAPSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
2-250 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

ASEDQAVVDAPSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAH

HMMPanther: PTHR10366
2-250 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

ASEDQAVVDAPSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAH

superfamily: SSF51735
18-250 NAD(P)-bd

PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAH

Gene3D: G3DSA:3.40.50.720
IPR016040
19-230 NAD(P)-bd
NAD(P)-binding domain

TVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEA

HMMPfam: PF01370
IPR001509
20-224 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox