PRGDB00067873 (Cca.5708)

From PRG Wiki
Jump to: navigation, search
Cca.5708
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 82473178 (DV693350)
Gene Class Unknown
Domain Type
Gene Species Coffea canephora

Comment?

CGN-37477 Leaf Coffea canephora cDNA clone cccl22b16 5', mRNA sequence

DNA Sequence

ATCGCATCCTTTAAATCCTAATTGGACAATTCAGTTTGTTGTGGATTGCCCAACAGCAGCGTCTTAACTTCAATGTGGATGTCATTGAAAGCGAATGGGGTCAAGGAGCAAACCTTGATATTTTGGCCTCAAAACTAGCAGAAGATACAGCACATACTATCAAGGCCATCTGCATCGTGCACAATGAAACAGCAACCGGTGTAACCAACAACTTGGCTACTGTTAGAAAGATTCTTGATCACTACAACCATCCAGCACTCTTTGTTGTTGATGGTGTTTCCTCCATTTGTGCACTTGATTTCCGCATGGATGAATGGGGAGTAGATGTGGCACTAACTGGCTCTCAGAAAGCTCTTTCTCTCCCAACTGGCATAGGAATCGTTTGTGCAAGCCCCAAGGCTCTTGAGGCTTCCAAAACAGCAAAATCTGTTAGAGTCTTCTTTGACTGGAAGGACTACCTGAAGGTCTATAAGTTGGGAACATATTGGCCATACACTCCATCCATTCATCTTCTATATGGTCTAAGAGCAGCTTTGGATCTCATATTTGAGGAAGGACTTGAGAATGTATTTGCCAGGCATGCTCGCTTAGCCAAAGCAACAAGACTTGCTATGGAAGCATGGGGCTTGAAAAATTGCACCCAAAAGGAGGAATGGTACAGTGATACAGTCACTGCTGTGCTTGTTCCTCCTAACATTGACAGTTCAGAAATTGTTAGAAGGGCCTGGAAGACATACAACTTAAGCTTGGGTCTGGGGCTTAACAAAGTTGCTGGAAAGGTTTTTAGAATAGGGCAT


Protein sequences

Name Description Sequence
Cca.5708 translated coding region predicted by ESTScan from UniGene Cca.5708

XSHPLNPNWTIQFVVDCPTAALNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKTYNLSLGLGLNKVAGKVFRIGH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
19-266 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TAALNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKTYNLSLGLGLNKVAGKVFRIGH

HMMPanther: PTHR21152
19-266 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

TAALNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKTYNLSLGLGLNKVAGKVFRIGH

superfamily: SSF53383
IPR015424
20-266 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

AALNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKTYNLSLGLGLNKVAGKVFRIGH

Gene3D: G3DSA:3.40.640.10
IPR015421
22-173 no description
Pyridoxal phosphate-dependent transferase, major r

LNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLY

HMMPfam: PF00266
IPR000192
22-239 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LNFNVDVIESEWGQGANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIV

PatternScan: PS00595
IPR020578
108-128 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
174-266 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKTYNLSLGLGLNKVAGKVFRIGH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox