PRGDB00067912 (Ccl.206)

From PRG Wiki
Jump to: navigation, search
Ccl.206
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 110841839 (DY260915)
Gene Class Unknown
Domain Type
Gene Species Citrus clementina

Comment?

KN0AAP1YA04FM1 Fruit-TF Citrus clementina cDNA 5', mRNA sequence

DNA Sequence

AAGCTCTCCGCCCAAAAAGAATTCATCTTCACAGCAAACGTTCGAGAAGTCTACCAGTTGAATCAATCACCACCCCCCAATACGTAAGCTCCAATTTGTAGCGTCGGTTTCGCCAGGCAATTTTGTGTGAGCTGGATCAAAATTTTAGATACTGAATCATCATATTTTGTGTTGGTGTGTTTTTTTGCCTGCGCAAATTCGATCTTGACTCGATGCAGTTGTTGAATACGTGGACTGAGTCGACAGATCACGTGAGAGATGGCGGCGTTTGAGCTGTATCGCAGGTCGACGATTGGGATGTGCTTAAGCGAGACTTTAGACGAGATGGTCCAGAACGGTACGCTTACTCCCGAGCTCGCTATGAGAGTTCTCGTCCAGTTCGATAAGGCTATGACAGAAGCGCTACAAACTCAGGTGAAGAGCAAGGTCGCCATTAAGGGGCATCTGCACACCTACAGGTTCTGTGACAATGTGTGGACATTCATCTTGCAAGATGCTTTGTTCAAGAGTGAGGAATTACAAGAGACCGTCGGTAGGGTGAAGATAGTGGCATGTGACTCAAAGCTGCTATCACAATAAGACAATGAAGATTGGTGTGTTGCTGGGGAATTAGGTTAAATTACTTGGAGAAGGTGGCAATTATGCATTAATGGTGAACCTAATTGGTAAAGCCGCCAACTGTTTTCAACTGGTGATGAATGTAAAGCCATTGAGGCTGCTACCACCTTGCTTTTGCGGATCTCAATAATGGGACCAATGGGGAGCATATTCCCCCACTGGACCCATTACCCCTTAAAATTTTGCTTATGGTGAGAAAAAGaatttattaccattaccagttaataatttaatttattattatcctaaattaaattaattGGTTGG


Protein sequences

Name Description Sequence
Ccl.206 translated coding region predicted by ESTScan from UniGene Ccl.206

MAAFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQTQVKSKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLLSQ

Domains

Domain Start-End Description Sequence

BlastProDom: PD009224
IPR015872
1-50 T2AG_ARATH_Q39236;
Transcription initiation factor IIA, gamma subunit

MAAFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQ

HMMPIR: PIRSF009415
IPR003194
1-106 Transcription initiation factor IIA, gamma subunit
Transcription initiation factor IIA, gamma subunit

MAAFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQTQVKSKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLLSQ

HMMPanther: PTHR10966
IPR003194
1-106 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MAAFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQTQVKSKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLLSQ

Gene3D: G3DSA:1.10.287.190
IPR015872
2-54 no description
Transcription initiation factor IIA, gamma subunit

AAFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQTQVK

HMMPfam: PF02268
IPR015872
3-50 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

AFELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQ

superfamily: SSF47396
IPR009083
4-54 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGMCLSETLDEMVQNGTLTPELAMRVLVQFDKAMTEALQTQVK

HMMPfam: PF02751
IPR015871
52-101 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDS

superfamily: SSF50784
IPR009088
52-102 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSK

Gene3D: G3DSA:2.30.18.10
IPR009088
55-104 no description
Transcription factor IIA, beta-barrel

SKVAIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox