PRGDB00067918 (Ccl.1713)

From PRG Wiki
Jump to: navigation, search
Ccl.1713
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63058712 (CX289858)
Gene Class Unknown
Domain Type
Gene Species Citrus clementina

Comment?

C02017H05SK IF1 Citrus clementina cDNA clone C02017H05, mRNA sequence

DNA Sequence

GAATTCGGCACGAGGGTCTTCTGTTTGGTCTTATCTTCTGGGACAAAGGACAGAAGACAAAGAAGCAACAAGATCTTCAGAATCTTTTCGGAGCTTTGTACTGTGCTGTGTTTTTCCTTGGATCCACCAATGCAAACTCAGTAATGTCCGTAGTCTCCACGGAGAGAACAGTTTTCTACCGCGAAAGAGCTGCTGGAATGTACTCTACACTAGCTTACGCTTTTTCGCAGGTGCTTATAGAGTTGATATATGTGGCATTTCAAACTGTCGTGTATGTTCTGATCCTATACTCCATGATGGGATTTGCGTGGAAAGCAAAAAGATTCTTCTGGTTCTTGTACATGGTAATGATGTCCTTTATGCAATTCACATTGTATGGGATGATGATTGTCGCACTGACTCCAGCTCCGCAAATTGGTGCCATACTTTCCGGATTCTTCCTCTCCCTGTGGAATTTGTTCTCTGGTTTTCTCATTCCTCGCGTGCAAATCCCAATTTGGTGGAGGTGGTACTACTGGCTCTCTCCCGTTGCTTGGACACTCTATGGCCTTGTTACAAGTCAAGTTGGTGACATAGAAGGCAACGTGGAAATTCCGGGAAGCACCGCTACGATGACAGTGAAGCAGCTTCTAAAGATAGTTTCGGGTTCAAGTATGACTTCCCTTCCGTTGTTGCTGTAGTCAAACTTGTCTGGCTTCTCGCCTTCGTCTTTGTGTTTACCCTTGCCATCACCTTATTAACTT


Protein sequences

Name Description Sequence
Ccl.1713 translated coding region predicted by ESTScan from UniGene Ccl.1713

XIRHEGLLFGLIFWDKGQKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPAPQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNVEIPGSTXYDDSEAASKDSFGFKYDFPSVVAVVKLVWLLAFVFVFTLAITLLTX


Domains

Domain Start-End Description Sequence

HMMPfam: PF01061
IPR013525
6-188 ABC2_membrane
ABC-2 type transporter

GLLFGLIFWDKGQKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPAPQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQ

HMMPanther: PTHR19241:SF10
6-247 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLLFGLIFWDKGQKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPAPQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNVEIPGSTXYDDSEAASKDSFGFKYDFPSVVAVVKLVWLLAFVFVFTLAITLL

HMMPanther: PTHR19241
6-247 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLLFGLIFWDKGQKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPAPQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNVEIPGSTXYDDSEAASKDSFGFKYDFPSVVAVVKLVWLLAFVFVFTLAITLL

Seg: seg
224-243 seg

VVAVVKLVWLLAFVFVFTLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox