PRGDB00067924 (Ccl.2278)

From PRG Wiki
Jump to: navigation, search
Ccl.2278
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63059211 (CX290357)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Citrus clementina

Comment?

C02023D02SK IF1 Citrus clementina cDNA clone C02023D02, mRNA sequence

DNA Sequence

CGAATCGGCACGAGGACCTTCTCCAGGTTACTTTGTACGATTGGATAAAGGTCCAGAAGACGATCTCTATTTGAAGAAGAGAGTAAAGATGCGTCGCTGGCTCTGTTGTACTTGTCAAGTAGAGGAGTCTTATCCATCTCATGAAAATGAGCGCCTGAAAAGCCCAAAGAATTATCCAGATGGGCACCACAAAAAGGTCCCAGCTCCGGTGAAACCTGAAGTGCAGAAGGCAGCACCACCTATTGAAGTGCCTGCATTGCCTTTGGATGAACTGAAAGAAAAGACGGACAATTTTGGATCAAAGGCATTGATTGGTGAGGGATCGTATGGAAGGGTGTATTATGCAAACTTAGAAAATGGCAAAGCAGTGGCTGTTAAAAAGCTTGATGTTTCCTCTGAGCCCGAGTCAAATGTTGAATTTTTGACTCAGGTTTCAGTTGTTTCAAGATTGAAGCATGAAAATCTTGTCGAGTTGCTCGGTTATTGTGTTGAAGGAAATCTCCGTGTTCTTGCTTATGAATTTGCTACAATGGGATCTCTTCATGACATATTGCATGGCAGAAAAGGAGTTCAGGGAGCACAACCAGGTCCAGTGCTTGACTGGATGACACGGGTTAGAATCGCAGTTGATGCAGCAAGGGGTTTGGAGTACTTGCATGAGAAGGTTCAACCTTCATGATACACAGAGATATCAGATC


Protein sequences

Name Description Sequence
Ccl.2278 translated coding region predicted by ESTScan from UniGene Ccl.2278

XESARGPSPGYFVRLDKGPEDDLYLKKRVKMRRWLCCTCQVEESYPSHENERLKSPKNYPDGHHKKVPAPVKPEVQKAAPPIEVPALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEKVQPSXYTEISDX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF416
72-226 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KPEVQKAAPPIEVPALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEKVQPS

HMMPanther: PTHR24420
72-226 FAMILY NOT NAMED,FAMILY NOT NAMED

KPEVQKAAPPIEVPALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEKVQPS

Gene3D: G3DSA:3.30.200.20
83-161 no description

EVPALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLG

superfamily: SSF56112
IPR011009
88-222 Protein kinase-like (PK-like)
Protein kinase-like domain

PLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEK

ProfileScan: PS50011
IPR000719
99-234 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEKVQPSXYTEISDX

HMMSmart: SM00219
IPR020635
99-234 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEKVQPSXYTEISDX

HMMPfam: PF07714
IPR001245
103-222 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEK

PatternScan: PS00107
IPR017441
105-128 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYANLENGKAVAVKK

Gene3D: G3DSA:1.10.510.10
162-222 no description

YCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMTRVRIAVDAARGLEYLHEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox