PRGDB00067930 (Ccl.2771)

From PRG Wiki
Jump to: navigation, search
Ccl.2771
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63067335 (CX298481)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Citrus clementina

Comment?

C06012F08SK RindPdig24 Citrus clementina cDNA clone C06012F08, mRNA sequence

DNA Sequence

GAGGGTTGCAGATAGTGAGTGGAAGGAGGAATTTCGAAGTCTCGCAAGAGACTAATCGAAAAAAGTTCTCTTTGTGGGCCTACGAAGAGTTCGAGAAGGGTAACGTTAAGGGAATTGTTGACAAAAGTTTAGCTGGTGAAGACGTGGATATTGAGCAAGTTATGAGGGCAATTCAAGTGAGCTTTTGGTGCATTCAGGAGCAACCATCTCAGAGGCCAATGATGGGAAAAGTGGTGCAGATGCTAGAAGGAATTACGGAGATCGAGAAGCCGCCGGCACCGAAGGCATTGACTGAAGGGTCTGTTGGTGGAACCAGCGTCAATATGAGTAGTAGCACCAGTGCTCTCTCAACTTTTGCAGCTTCAGCACCAGCCCCATCTTCATCCTCGTCAACTCATACTGGAGTTTCGGCTTTAGCTTCGGATAGGAATATCGAAAGGGCATCTTCATCCCTTTTGCGATCATCAAGCCCAAACTGACGTGCATTTCAAATTAATGTTACCAATATTCAATATTATGTAATTTTTTTATTTATGGTGCATCACCATCAGAAATTAGTTGCCTGTACAAGTATTTTTAATGGAAGTCCATTCGAGAAATATGTAAATAGTAACGCTTGCAAGTAAATGCTTGCtaaataaaaaaaattattatctgttaaaaaaaa


Protein sequences

Name Description Sequence
Ccl.2771 translated coding region predicted by ESTScan from UniGene Ccl.2771

XGLQIVSGRRNFEVSQETNRKKFSLWAYEEFEKGNVKGIVDKSLAGEDVDIEQVMRAIQVSFWCIQEQPSQRPMMGKVVQMLEGITEIEKPPAPKALTEGSVGGTSVNMSSSTSALSTFAASAPAPSSSSSTHTGVSALASDRNIERASSSLLRSSSPN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF814
3-159 SUBFAMILY NOT NAMED

LQIVSGRRNFEVSQETNRKKFSLWAYEEFEKGNVKGIVDKSLAGEDVDIEQVMRAIQVSFWCIQEQPSQRPMMGKVVQMLEGITEIEKPPAPKALTEGSVGGTSVNMSSSTSALSTFAASAPAPSSSSSTHTGVSALASDRNIERASSSLLRSSSPN

HMMPanther: PTHR24420
3-159 FAMILY NOT NAMED,FAMILY NOT NAMED

LQIVSGRRNFEVSQETNRKKFSLWAYEEFEKGNVKGIVDKSLAGEDVDIEQVMRAIQVSFWCIQEQPSQRPMMGKVVQMLEGITEIEKPPAPKALTEGSVGGTSVNMSSSTSALSTFAASAPAPSSSSSTHTGVSALASDRNIERASSSLLRSSSPN

Seg: seg
100-138 seg

GSVGGTSVNMSSSTSALSTFAASAPAPSSSSSTHTGVSA

Seg: seg
149-157 seg

SSSLLRSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox