PRGDB00067936 (Ccl.4573)

From PRG Wiki
Jump to: navigation, search
Ccl.4573
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63063904 (CX295050)
Gene Class Unknown
Domain Type
Gene Species Citrus clementina

Comment?

C05068A09SK DroRLeaf1 Citrus clementina cDNA clone C05068A09, mRNA sequence

DNA Sequence

GAGGCACAACTTGTCTAAGTGAGAAAACTTCTTGATGAATACAGGCACCCGGCTCTTTTTCTCGTTGACGGGGTTTCCTCCATTTGTGCCATCGATTTCCGTATGGATGAATGGGGCATAGATGTGGCTCTAACTGGCTCTCAGAAAGCTCTTTCACTTCCTACTGGAATGGGGATTGTTTGTGCAAGCCCCAAAGCTCTAGAGGCATCCAAAACTGCAAAATCTGTCAGAGTTTTCTTTGATTGGAAAGACTACATAAAGTTTTACAATTTGGGAACATTTTGGCCATATACCCCTTCCATCCAACTGCTGTATGGGCTGCGAGCAGCTTTGGATCTGATTTTTGAGGAAGGGCTTGAAAATGTGATCGAAAGGCACCGTCGTTTGGGCAAAGCAACCAGGCTTGCGGTGGAGGCATGGGGATTAAAGAACTGCACCCAGAAAGAAGAATGGTTCAGTGACACCGTGACTGCTGTGATTGTTCCTCCACATATCAATAGTTCAGAAATTGTTAGAAGGGCATGGCAGAGATACAATCTAAGCTTAGGTCTGGGCCTTAACAAAGTTGCTGGTAAAGTATTTAGAATCGGGCATCTCGGCCACCTGAATGAGTTGCAATTGTTGGGCTGTCTCGCTGGTGTGGAGATGATACTAAAAGACGTGGGCTACCCGGTTAAGCTGGGGAGCGGGGTTGCAGCTGCTTCTGCATACCTACAGAACAACATTCCTATGAT


Protein sequences

Name Description Sequence
Ccl.4573 translated coding region predicted by ESTScan from UniGene Ccl.4573

EAQLVXVRKLLDEYRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
4-244 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LVXVRKLLDEYRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPM

HMMPanther: PTHR21152
4-244 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

LVXVRKLLDEYRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPM

superfamily: SSF53383
IPR015424
7-225 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

VRKLLDEYRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPV

Gene3D: G3DSA:3.40.640.10
IPR015421
7-106 no description
Pyridoxal phosphate-dependent transferase, major r

VRKLLDEYRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYG

HMMPfam: PF00266
IPR000192
16-171 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

HPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIV

PatternScan: PS00595
IPR020578
40-60 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

IDVALTGSQKALSLPTGMGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
107-231 no description
Pyridoxal phosphate-dependent transferase, major r

LRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox