PRGDB00068007 (Ccl.20276)

From PRG Wiki
Jump to: navigation, search
Ccl.20276
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63068325 (CX299471)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Citrus clementina

Comment?

C06022G11SK RindPdig24 Citrus clementina cDNA clone C06022G11, mRNA sequence

DNA Sequence

AGGTGCCATTGATGTTGCAAATGGCTTGCAATACATACATGAGCACACTAGGCCTAGAGTGGTACACAAAGACATCAAAAGCAGTAACATTCTCTTAGACTCAAACATGAGAGCCAAAATTGCCAACTTTGGATTAGCAAAATCTGGCTGCAATGCCATAACAATGCACATTGTTGGAACTCAAGGCTACATTGCTCCAGAGTACTTAGCAGATGGGGTAGTATCGACGAAAATGGATGTGTTCTCTTTTGGGGTGGTGTTGCTTGAGCTGATATCTGGCAAGGAAGCAATTGATGAAGAGGGGAAGGTTTTGTGGGCAAAAGTTGAAGGGATACTGGAGGGAAATGAAGAGAGGAAAGTAAAGAGAGTGAAGGAATGGATGGATGAGATTCTTTTGAAGGATTCAATCTCAATGGAGAGTGTGATGAGTGCAATGGGAATTGCCATTGCGTGTCTGCACAAAGATCCTTCGAAAAGGCCAAGTATGGTCGATATTGTGTATGCTTTGAGCAAGAGTGATGACTTGCTTTCCGACATTTCAGATGATGCATTATCATCCTCTCAGGTTTCGGCAAGATGAATCAGAATCATATTATGGTAGTAATTATGCAGGGTGTAAATAATAATAAGCATACGGGTTAAAAGCCAAAACAGGGCTGTTCTAGAACTTAAACGCTCT


Protein sequences

Name Description Sequence
Ccl.20276 translated coding region predicted by ESTScan from UniGene Ccl.20276

XGAIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDDLLSDISDDALSSSQVSAR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-177 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGAIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDDLL

HMMSmart: SM00219
IPR020635
2-170 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GAIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYAL

superfamily: SSF56112
IPR011009
3-170 Protein kinase-like (PK-like)
Protein kinase-like domain

AIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYAL

HMMPanther: PTHR24420:SF591
3-171 OS02G0681700 PROTEIN

AIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALS

HMMPanther: PTHR24420
3-171 FAMILY NOT NAMED,FAMILY NOT NAMED

AIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALS

HMMSmart: SM00220
IPR002290
3-177 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

AIDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDDLL

Gene3D: G3DSA:1.10.510.10
4-175 no description

IDVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDD

HMMPfam: PF00069
IPR017442
5-167 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DVANGLQYIHEHTRPRVVHKDIKSSNILLDSNMRAKIANFGLAKSGCNAITMHIVGTQGYIAPEYLADGVVSTKMDVFSFGVVLLELISGKEAIDEEGKVLWAKVEGILEGNEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIV

PatternScan: PS00108
IPR008271
21-33 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHKDIKSSNILL

Seg: seg
170-188 seg

LSKSDDLLSDISDDALSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox