PRGDB00068056 (Cre.3759)

From PRG Wiki
Jump to: navigation, search
Cre.3759
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159488201 (XM_001702054)
Gene Class Unknown
Domain Type
Gene Species Chlamydomonas reinhardtii

Comment?

Chlamydomonas reinhardtii strain CC-503 cw92 mt+

DNA Sequence

ATTATTTCAAAGCAACAAGTGAAGCTTCTCGAATAGCACTGCCTTACAAAGCACAGGCTCTAGCGTCAGTCTACCCAGCCCTAGTTCGACTTGACTTGCAGAGAGCCATGGCCCTTCGCGAGGTGTCGCAGAAGCGGGTGCTACCGCTGCTCGCGCAATTCACGCGCGGGTTGAGTGCCAGCGCGATGCCCGAGCAGGTCTCGCTTGACGCGAACGCTCCTATCTCGCAGCCGGCGCCGTTTTCCTACGTGCCGCCTGGTCGGAACCACCTCTTCGTGCCGGGCCCGGTCAACATCCACGAGCGAGTGCTGCGCGCGATGCACGTGCCCGGCCAGAACCACCGCGACCCCTGGTTTGCGGAGTTCTACAAGGAGTGTCTGGAGGACACCAAGCACATGTACGGCACCAAGGCCGCTACCCCCTTCATCTTCCCCGGCACCGGCACTGGAGGCTGGGAGGCTGCGCTCTGTAACACGCTGTCACCCGGTGACAAGGTCATCTGCTTCCGCTACGGCCTGTTCTCTCACCTGTGGATTGACATGATGCAGCGCCTGGGCCTGGACGTGACGGTGGTGGACCGGCCCTGGGGCGAGGGCGCAGACGAGGGCGCGCTGGAGGAGCTCCTGCGCAAGGACACGGGCAAGAAGATCAAGGCGGTGTGCGTGGTGCACAATGAAACCACCACCGGCGTCACCTCCGACATCGCGGGCTGCCGCAAGGCCATGGACGCCGCGGGCCACCCGGCGCTGCTGCTGGTGGACGGTGTCAGCTCCATCGGCGCCCTGGAGTTCAAGATGGACGACTGGCGGGTGGACGTGGCCGTGACCGGCAGCCAGAAGGCGATGTCGCTGCCCACCGGCCTGGCCTTTGTGGCGGCCTCGCCCAAGGCTCTGGAGGCGATGAAGAGCGCCAAGCTCAAGCGCGTGTATTATGACTTTGCGGACATGCTGCGCACCAACCCCTCCGGCAACGTGCCGTACACGCCCTGCCTGTCGCTGCTGTACGGGCTGCGCGAGAGCATCAAGATGTGGAAGGAGGAGGGTGGCATGGAGGCCGTGGCGGCGCGCCACCACAGGCTGGCGGAGGGCGTGCGGCAGGCGGTGGACGGCTGGGGCCTGAAGCTGCTGTGCAAGAACCCCCGGTGGCGGTCCGACTCGCTGACGGTAGTGGAGGTGCCCGAGGGCGTGGACAGCAACAAGATTGTGAAGAACGCATACGCCAAGTACGACCTGTCGCTGGGCATCGGCCTGGCGTCCATCAACGGCAAGGTGTTCCGCATCGGCCACCTGGGCAACATGAACGAGCTGATGCTGGCGGGCGCGCTGGTGGGCGCGGAGATGGCCATGATCGACTCAGGCATCAGCATCAAGCCCGGCAGTGGCGTGGCGCGCGCTACCGAGTACTGGCACAAGACGGGGTCGGTCATCAAGACGCGCGAGAGCCTCCTGAAGTAAACGGTGAAACATAGTGGGCGTGAGCGTTGTGGCCGACGAGGGGAAGGGCGTTGTCGGGCTGGTAAAGGAGCGGCGACAGTGGACTTAGTGGGGCGCGTTGAATGCGGCGCAACCCGTTTGCATGGCCCGTCGCTTCGTGACGGGCTTACGAAGTAGCAGCTAGCTAGAGGCAGAGGGCGCGGCTGCACAGCCGCAGCGTCACTGGCACGTAGTGGCTACACCGCAAGGAAGTTAAGGGTGTGGATCGTGTTTGTTCGTTAAAGGATTGAGAGAAGATTCTTCACAAAAAGCAATAGCATTGGGCATCCGGCTTATTCCTTGTTGCGTTGTGTCACACAGTAGCAGCTGGCGACAGCGGGGGCAGGCTCCGTGCAGTCTGCTGAGCCCGTGAGCGCCGCCGTTGTTCGCAAGCTGCACCGCCGGCCTCGCAACCATGTTGCCAACATGTTTTATTATATTACCACTCGCGTGTTCGGAGAGCAAGAGGGGGTTAGCGAGCGAGGGCGGGCGCAGGGATTCTAAGTGATACCGCCGCCCCGCGAGGGAGCCCCGTCGCCCCCAGCATGAGCGATGATGACTGCGTGTGTGCACTAGCGCAACCTGATGATGCAAGCTTGGATCACGGTTTCGAGTGTGCGTGTGTGGGCACACCCGGGCGCTTCGGATTGCGGTTGTACGCTATTTACCCCCATGTTGTACAGTGTGGATGACTCCCGGCGCAAGGCGCAATTTTTGTTTGTTACCAGTTTAGCGCCTTGATGTGCGGGAAGGGCCTGGGCATTGACACGGTGTTCGGACTGGTCATGAAGGAGAGGTGATGGTGCGTGAGGCACAGGAGCCGGGGAGGGCATGGCTTAAGCTGTCTGCAACTAAGCCACGGAGCCTGTAATATTTCAGCCTTGGCTTTCATTGCTTTCCGCACGCGGACGACGCAGTACACAATGAAGTGACTCACGAA


Protein sequences

Name Description Sequence
Cre.3759 translated coding region predicted by ESTScan from UniGene Cre.3759

XYFKATSEASRIALPYKAQALASVYPALVRLDLQRAMALREVSQKRVLPLLAQFTRGLSASAMPEQVSLDANAPISQPAPFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCRKAMDAAXPPGAAAGGRCQLHRRPGVQDGRLAGGRGRDRQPEGDVAAHRPGLCGGLAQGSGGDEERQAQARVLXLCGHAAHQPLRQRAVHALPVAAVRAAREHQDVEGGGWHGGRGGAPPQAGGGRAAGGGRLGPEAAVQEPPVAVRLADGSGGARGRGQQQDCEERIRQVRPVAGHRPGVHQRQGVPHRPPGQHERADAGGRAGGRGDGHDRLRHQHQARQWRGARYRVLAQDGVGHQDAREPPEETVKHSGRERCGRRGEGRCRAGKGAATVDLVGRVECGATRLHGPSLRDGLTKXQLARGRGRGCTAAASLARSGYTARKLRVWIVFVRXRIERRFFTKSNSIGHPAYSLLRCVTQXQLATAGAGSVQSAEPVSAAVVRKLHRRPRNHVANMFYYITTRVFGEQEGVSERGRAAGILSDTAAPRGSPVAPSMSDDDCVCALAQPDDASLDHGFECACVGTPGRFGLRLYAIYPHVVQCGXLPAQGAIFVCYQFSALMCGKGLGIDTVFGXGHEGEVMVREAQEPGRAWLKLSATKPRSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
77-248 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QPAPFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCRKAMDAAXPP

HMMPanther: PTHR21152
77-248 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

QPAPFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCRKAMDAAXPP

superfamily: SSF53383
IPR015424
86-244 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCRKAMDA

Gene3D: G3DSA:3.40.640.10
IPR015421
100-243 no description
Pyridoxal phosphate-dependent transferase, major r

HERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCRKAMD

HMMPfam: PF00266
IPR000192
111-239 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

GQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCR

Seg: seg
146-151 seg

GTGTGG

Seg: seg
197-209 seg

GEGADEGALEELL

Seg: seg
244-254 seg

AAXPPGAAAGG

Seg: seg
266-277 seg

DGRLAGGRGRDR

Seg: seg
289-300 seg

GLCGGLAQGSGG

Seg: seg
346-376 seg

GGGWHGGRGGAPPQAGGGRAAGGGRLGPEAA

Seg: seg
387-401 seg

ADGSGGARGRGQQQD

Seg: seg
435-451 seg

RADAGGRAGGRGDGHDR

Seg: seg
491-510 seg

GRERCGRRGEGRCRAGKGAA

Seg: seg
541-546 seg

RGRGRG

Seg: seg
564-579 seg

RVWIVFVRXRIERRFF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox