PRGDB00068140 (Csi.6766)

From PRG Wiki
Jump to: navigation, search
Csi.6766
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 188330217 (EY658058)
Gene Class Unknown
Domain Type
Gene Species Citrus sinensis

Comment?

CS00-C1-100-132-B05-CT.F Sweet orange leaf, greenhouse plant Citrus sinensis cDNA, mRNA sequence

DNA Sequence

AATAATTTATTAAGGGAACCTGCGGTACGGGTCGGAATTCCGGGTCGACCACGCGTCCGCTTCCTCTTCAGGTCAGGTGTTTTGGAGTGGTGAAACAACAAGAACTCGTCAAACTTTAAGGTATCAGTGACATTCCAAGTAGGGAAAGATGGACTATATGTATGCACCAGGGAAGAACCATCTCTTTGTTCCGGGTCCTGTTCACATCCCCGATCAAGTCATCCGAGCAATGAATAGGAACAATGAGGACTACCGTTCTCCAGCAGTTCCAGCATTAACAAAAATTCTTCTTGAGGATGTCAAGAAAATTTTCAAGACCACTTCTGGAACTCCATTTCTGATCCCAACCACAGGAACTGGTGCATGGGAGAGTGCACTTACAAACACACTGTCTCCTGGAGATCGCATTATCTCTTTTCTGATTGGTCAATTCAGTTTGCTTTGGATTGATCAGCAGCAGCGCCTCAACTTCAACGTTGATGTCGTCGAAAAGTGACTGGGGTGAAGGTGCAAAGCTTGATGGTTTTTGGCATCAAAACTTTGCAGCAGAAACTGGACAACCTTATCAAGCCCATTTTGCATTTGTTCATAACGAAAACGCCAACCGGGAGTTACCAACAACTTGGCTaaaatgaaaaaaaaCTTCTTGGAAGAATAACAGGCCCCCGGCTTCTTTTTTCTCTTTTGAAAGGGGGTTTCCCCCCATTTTGTGGCCTCCGATTTTTCCGTAATGGGAAAGAAAATGGGGGGCTAAAAGTGGGGGCTTCTAACGGGCCTCCCACAAAAACCCCTTTCCCTTTCCCTAATGGAAAGGGGGAAGTTTTTGGGGGCAACCCCCACAAACCTTTAAGAGGGATCCCCCaaaaatggcaaaaaaaccggtgaaaaatttttttttttggttgggaaaaaaatcaacaaaaaagatttttttaaaaatttgggggaaaaattttttgtgggcactatccaccccccctcccaccccccAATCAGTTGAGAGTGGTGGGGAGGGAGGAAGAAACATCTCTTATATGAATATTTGAAAATTTTTATTTTTGAAGAGAAGAGGAGCGTGTTGTAGAACAAGTTGGGTGTGATTCATATTGTAAATGGACGGAGCCNCCC


Protein sequences

Name Description Sequence
Csi.6766 translated coding region predicted by ESTScan from UniGene Csi.6766

MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVEKDWGEGAKLDGFWHQNFAAETGQPYQAHFAFVHNENANRELPTTWLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-124 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVEKDWGEGAKLD

HMMPanther: PTHR21152
1-124 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVEKDWGEGAKLD

superfamily: SSF53383
IPR015424
7-124 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVEKDWGEGAKLD

Gene3D: G3DSA:3.40.640.10
IPR015421
21-124 no description
Pyridoxal phosphate-dependent transferase, major r

PDQVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVEKDWGEGAKLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox