PRGDB00068158 (Csi.8546)

From PRG Wiki
Jump to: navigation, search
Csi.8546
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 55397860 (CV715162)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Citrus sinensis

Comment?

UCRCS08_0005F18_f Parent Washington Navel Orange Callus cDNA Library UCRCS08-1 Citrus sinensis cDNA clone CS_AEa0005F18, mRNA sequence

DNA Sequence

AGGTCGAACAACAACGACCTCGAACCAGACGAACGAACCAGGTCGCAGGGTGGCTTGAAGATGTGCAAAATCTTGAAACTGAATTTGCCGAGCTGGAACGAGTCAGAGCTCAAGAAATGGATAGATTGTGCCTTGGAGGCCTCTGTTCCAAAAACTTCGTTTCAAGCTACAATTACGGGACTAAGGTGGTCGAGTTGACGGATCGAGTCATCAATTTAAAGAAAGACGGAGAAAAAATTGAAGTCGTTGTTGAGAAGGCGCCGGATGGTGCAGCAATTGAATTACCTCTTGATCACACAGTTGTTGGTCAAGAACTATTACTTGGTCAAGTTTGGAGATGTATCACTGATCAGGAAAAGAACAGGGGAATTATCGGCTTGTATGGTATAGGGGGAGTCGGCAAAACTACCCTTTTAAAACAAGTCAACAACAACTTCTGCCATCAACAGCATAATTTTGATGTTGTTATCTGGGCGGCTGTGTCAACACTTCAAGATGACATTGGAAAAAGGATTGGCTTTTCAGAAGACAGAAACTGGCAGGAAAAAAGTCTTCAAGACAAGGCTATGGACATCGCTAGCATTCTAAGCGGAAAGAAGTTTGTGTTGTTATTAGATGATATATGGGAGCCCATTGATTTAACACAGTTGGGTGTCCCTCTTCAAAATCTAAATGATGGGTCCAAAATAGTCTTGACAACTCATTCAGCTGGTTTTTGCGATCAAATGGACGCTAAAAAGTTGGAAG


Protein sequences

Name Description Sequence
Csi.8546 translated coding region predicted by ESTScan from UniGene Csi.8546

XVEQQRPRTRRTNQVAGWLEDVQNLETEFAELERVRAQEMDRLCLGGLCSKNFVSSYNYGTKVVELTDRVINLKKDGEKIEVVVEKAPDGAAIELPLDHTVVGQELLLGQVWRCITDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDGSKIVLTTHSAGFCDQMDAKKLEX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
2-227 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VEQQRPRTRRTNQVAGWLEDVQNLETEFAELERVRAQEMDRLCLGGLCSKNFVSSYNYGTKVVELTDRVINLKKDGEKIEVVVEKAPDGAAIELPLDHTVVGQELLLGQVWRCITDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDG

HMMPanther: PTHR23155
2-227 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEQQRPRTRRTNQVAGWLEDVQNLETEFAELERVRAQEMDRLCLGGLCSKNFVSSYNYGTKVVELTDRVINLKKDGEKIEVVVEKAPDGAAIELPLDHTVVGQELLLGQVWRCITDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDG

Coil: coil
15-43 coiled-coil

VAGWLEDVQNLETEFAELERVRAQEMDRL

superfamily: SSF52540
94-244 P-loop containing nucleoside triphosphate hydrolases

ELPLDHTVVGQELLLGQVWRCITDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDGSKIVLTTHSAGFCDQMD

HMMPfam: PF00931
IPR002182
108-246 NB-ARC,NBS
NB-ARC

LGQVWRCITDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDGSKIVLTTHSAGFCDQMDAK

Gene3D: G3DSA:3.40.50.300
116-244 no description

TDQEKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVSTLQDDIGKRIGFSEDRNWQEKSLQDKAMDIASILSGKKFVLLLDDIWEPIDLTQLGVPLQNLNDGSKIVLTTHSAGFCDQMD

Seg: seg
123-134 seg

GIIGLYGIGGVG

FPrintScan: PR00364
IPR000767
124-139 DISEASERSIST
Disease resistance protein

IIGLYGIGGVGKTTLL

FPrintScan: PR00364
IPR000767
195-209 DISEASERSIST
Disease resistance protein

ILSGKKFVLLLDDIW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox