PRGDB00068321 (Ghi.124)

From PRG Wiki
Jump to: navigation, search
Ghi.124
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 109875767 (DW504741)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

GH_TMIRS_087_B06_F Cotton Normalized Library dT primed Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

AAACCAATCacaacggcaacaacaacaacaacaacaGCAGCAGCCGTCTACCTCAGGCAAGTAACGGTCCTGCTCAACCCTCCTACGGAACAGATTCACTTGGCGCTGCCGCCGGTGGCGTCCCTTATTTCTCGGAGTTCTCTCTAGCTGAGCTTAAGGCTGCCACCAACAACTTTAGCTCCGATTTCATCGTTTCCGAAAGTGGTGAAAAGGCTCCCAATGTGGTCTACAAAGGCCGCCTCCAAAACGATACTAATCGCCGTTGGACCGCCATAAAAAAGTTCGCCAAATTAGCCTGGCCCAATCCCAAACAATTCGCCGATGAAGCTTGGGGTGTTGGAAAGCTGAGACATAAGAGATTGGTGAATTTGATTGGCTATTGCTGTGACGGTGACGAGAGATTGCTTGTTGCTGAATACATGCCAAATGATACCCTCGCAAAGCATTTATTTCACTGGGAGAACCAGACTATCGAGTGGGCCATGCGGTTGCGAGTTGCTTTATTTATAGCTGAAGCATTAGATTATTGTAGCAGTGAAGGTCGTCCATTGTACCATGATTTGAATGCATATAGGGTTCTCTTTGATGAGAATGGTGATCCTCGACTTTCGTGTTTTGGCTTGATGAAGAACAGTAGGGATGGAAAAAGCTATAGTACCAATCTTGCATATACGCCTCCTGAGTATCTAAGAAATGGAAGGGTCACTCCTGAAAGTGTAATATTCAGCTTTGGAACGGTCCTTTTGGATCTTCTCAGTGGAAAGCACATTCCCCCAAGTCATGCCCTTGATATGATTCGGGGAAAAAACATTCTTCTTTTGATGGATTCTCATCTAGAGGGAAACTTTTCAACTGAAGAGGCAACAGTGGTCTTTGATCTTGCCTCACGATGTTTGNCATATGAACCAAGGGAGCGGCCAAATA


Protein sequences

Name Description Sequence
Ghi.124 translated coding region predicted by ESTScan from UniGene Ghi.124

XTNHNGNNNNNNSSSRLPQASNGPAQPSYGTDSLGAAAGGVPYFSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPNX

Domains

Domain Start-End Description Sequence

Seg: seg
3-15 seg

NHNGNNNNNNSSS

superfamily: SSF56112
IPR011009
31-308 Protein kinase-like (PK-like)
Protein kinase-like domain

TDSLGAAAGGVPYFSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

HMMPanther: PTHR24420:SF885
41-308 SUBFAMILY NOT NAMED

VPYFSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

HMMPanther: PTHR24420
41-308 FAMILY NOT NAMED,FAMILY NOT NAMED

VPYFSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

Gene3D: G3DSA:3.30.200.20
45-127 no description

SEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGY

ProfileScan: PS50011
IPR000719
62-309 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPNX

HMMSmart: SM00220
IPR002290
62-308 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DFIVSESGEKAPNVVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

HMMPfam: PF07714
IPR001245
75-308 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

HMMSmart: SM00219
IPR020635
75-308 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VVYKGRLQNDTNRRWTAIKKFAKLAWPNPKQFADEAWGVGKLRHKRLVNLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN

Gene3D: G3DSA:1.10.510.10
128-308 no description

CCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRLRVALFIAEALDYCSSEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFSTEEATVVFDLASRCLXYEPRERPN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox