PRGDB00068322 (Ghi.134)

From PRG Wiki
Jump to: navigation, search
Ghi.134
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84173923 (DR462571)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Gossypium hirsutum

Comment?

CM109D01 Cotton Lambda Zap Express Library Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

AAAAACTGATGTTTATGGCTACGGTGTCATGCTTCTTGAACTCATTACAGGACAGAGGGCTTTCGATGTAGCTCGGCTTGCAAATGATGATGATGTCATGTTGCTTGATTGGGTAAAAGGGCTTCTGAAAGACAGGAGGTTAGAAACGTTGGTTGATGCTGATCTTCAAGGTAATTACATAGACCATGAAGTAGAACAGCTAATCCAGGTAGCTCTTGGATGCACTCAAGGCACCCCAATGGAACGACCAAAGATGTCCGAAGTGGTCAGGATGTTGGAGGGTGATGGATTAGCCGAAAGATGGGAAGAGTGGCAGAAAGAGGAAATGTTCCGGCGAGAGTTTAACCATAACCACCAAACGAATGCTGATTGGATCATTGCAGACTCCACTTCTTACCTCCGACCAGACGAATTATCCGGTCCTAGATGAACCCATTTCTACAAAAATACAAAACACCTCTGGCGGTCAGAGTTGGTGCATTGTTCACCATTTTGTGGATATACAATATAGGTGTCTCAGGGTTGCCAACTGCAGCAGTCAAGAGAAACATTAGGTGCTATaaaaaaaaaacaaaaaaa


Protein sequences

Name Description Sequence
Ghi.134 translated coding region predicted by ESTScan from UniGene Ghi.134

XKTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRREFNHNHQTNADWIIADSTSYLRPDELSGPR

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-141 Protein kinase-like (PK-like)
Protein kinase-like domain

KTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRREFNHNHQTNADWIIADSTSYLRPDELSG

HMMPanther: PTHR24420:SF351
2-135 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRREFNHNHQTNADWIIADSTSYLR

HMMPanther: PTHR24420
2-135 FAMILY NOT NAMED,FAMILY NOT NAMED

KTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRREFNHNHQTNADWIIADSTSYLR

Gene3D: G3DSA:1.10.510.10
2-93 no description

KTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRML

HMMPfam: PF07714
IPR001245
2-93 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KTDVYGYGVMLLELITGQRAFDVARLANDDDVMLLDWVKGLLKDRRLETLVDADLQGNYIDHEVEQLIQVALGCTQGTPMERPKMSEVVRML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox