PRGDB00068323 (Ghi.144)

From PRG Wiki
Jump to: navigation, search
Ghi.144
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78352962 (DT573236)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

EST1083876 TMO Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

AAAATTTACATTAACATTGACTAATGACCGTTTCTCAATTCTCCTTAAACCTAGTCCAACCATCGCCATTCTTTTCCTTCAAAATCAACCAAAATCATTTTTCATTTTCTCTCTTTTAAGCCCTGCTACGTCCTACCTTCTCCTGTTTCTCAACTCAAGAAATGGTGTAAATGATGTGATCTGGGAGAGGTTGGTGAGTGAGATATTGCAGAGAACGATATGAGTTGCGGTTGTTTTGGTGGATCAGTTGTTAAGCGGAGACAGAGCACCGCTCGGGCCACCGGCGGTATAGACGAGCAATTAATTCGGACAGTCAACCATTTCTCATACGATCAATTAAAATTAGCCACAGATGATTTTCATTCAAGCAATAAAATAGGTCGTGGAGGTTTTGGAACCGTTTACAAGGGAATTCTAAAAGATGGAACTGAAGTTGCTGTGAAGACACTTGCAGCACAATCGAAGCAGGGAGCTCATGAATTTTTGACGGAGATCAATACTATATCAAATGTCAAGCATCCGAACCTTGTAGAGCTGATCGGGTGTTGCATTCAAGGAGCGAATCGTATATTGGTCTATGAATACGTTGAAAATAAGAGTCTTGATAAAGTTTTATTAGACCAAAGGAGTACGAATATCCAACTGGACTGGAGCAAAAGATCTGCTATTTGCATGGGTATAGCTAGGGGTCTTGCTTTCCTTCATGAAGAACTTGTTCCACGTATCGTTCATAGAGACATCAAATCTAGTAACATACTTCTTGACAAAGACTTTAACCCTAAAATTGGAGATTTTGGGTTGGCTAAACTTTTTCCAGATAACATCACTCATATTAGTACCAGGATAGCACGAACAACTGGTTATTTGGCCCCGGAATATGCTTTGGGTGGTCAGTTAACCATGAAGGCTGACGTTTATA


Protein sequences

Name Description Sequence
Ghi.144 translated coding region predicted by ESTScan from UniGene Ghi.144

MSCGCFGGSVVKRRQSTARATGGIDEQLIRTVNHFSYDQLKLATDDFHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVYX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
19-233 Protein kinase-like (PK-like)
Protein kinase-like domain

RATGGIDEQLIRTVNHFSYDQLKLATDDFHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVY

Gene3D: G3DSA:3.30.200.20
30-109 no description

RTVNHFSYDQLKLATDDFHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGC

HMMPanther: PTHR24420:SF679
35-233 SUBFAMILY NOT NAMED

FSYDQLKLATDDFHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVY

HMMPanther: PTHR24420
35-233 FAMILY NOT NAMED,FAMILY NOT NAMED

FSYDQLKLATDDFHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVY

ProfileScan: PS50011
IPR000719
47-234 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVYX

HMMSmart: SM00220
IPR002290
47-234 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVYX

HMMSmart: SM00219
IPR020635
47-232 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADV

HMMPfam: PF00069
IPR017442
48-233 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HSSNKIGRGGFGTVYKGILKDGTEVAVKTLAAQSKQGAHEFLTEINTISNVKHPNLVELIGCCIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVY

PatternScan: PS00107
IPR017441
53-75 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFGTVYKGILKDGTEVAVK

Gene3D: G3DSA:1.10.510.10
110-233 no description

CIQGANRILVYEYVENKSLDKVLLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKSSNILLDKDFNPKIGDFGLAKLFPDNITHISTRIARTTGYLAPEYALGGQLTMKADVY

PatternScan: PS00108
IPR008271
169-181 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox