PRGDB00068324 (Ghi.336)

From PRG Wiki
Jump to: navigation, search
Ghi.336
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164248397 (ES831902)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_326_57 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGATTTAGTGTTCGTCGGTGGTGAAGTTGAAGGTTATAGTTTAGAACAGTTAATGAGAGCTTCAGCCGAGTTATTAGGGAGAGGTACAATGGCAACTACGTATAAGGCAGTGGTTGATCGGCAATTGATTTTGACGGTGAAGAGATTGGACGCTGGCAGAACAGCGGTGACCGGCGGTGAAGCTTTTGAACAACATATGGAGGCTGTTGGTGGGTTGGTACATCCCAATTTAGTGCCCCTTAGAGCTTATTTTCAAGCCAAAGGTGAAAGACTTGTGATCTATGATTATCAACCCAATGGAAGTGTTTTCAATCTTGTTCATGGTTCAAGATCCACAAGGGCAAAGCCACTTCATTGGACATCATGTTTAAAGATAGCTGAAGATGTAGCACAAGGCCTTGCTTACATCCACCAAGCATCAAGGCTCGTCCACGGCAACTTGAAATCCACCAACGTGCTCCTCGGGACTGATTTCGAAGCCTGCCTTACCGACTATTGCCTCGCTGTCCTTGCAGATTCTTCTTCAACCGAAGATCCCGATTCTTTAGCCTATAAAGCTCCCGAGATTCGAAAATCCAACCGCAAGCTCACTCCCAAATCCGATGTTTACGCTTTCGGCGTCTTCTTACTCGAGCTATTGACAGGTAAACATCCCTCGCAACATCCGGTGCTCGTGCCCCATGACTTGTTGGAATGGGTTAGAACGATACGAGAAGATGATGTAGGGGAATATCGTTGGCTTGNGATGTTGACTGAAGTTGCTAGTGTTTGTAGCTTAACGTCGCCGGAGCAGAGGCCGGCGATGTGGCAAGCGTTGAAGATGATACAAGAGATAAAGGAGAGTGCAATGATGGAGGATAGGGCATCTTTTGGACATTCATAGCANATGCATAAAAGATTATGCATGTTTCAAAGAGGGGAGCAAATTGGGATTTTATTGTGTGGTTGGTATTCAGGGTTTTGTATATGACGATCCAATGTTATCTATAATTATACGTGGAGGTAAGGGAATATACCATGTTTTACAAAAGGGCTGCTTAAGCAATTTTTCATTATCaaaaaaaaaaaaaaaaaaaactccgaaaagaacttcttaaagggggccccccggggcccccccaatttttccccccccgggggggggggTACCCCCGGAGAAGGGGGTCCACCAAATTTTTCCCCCCCTATATAGGGGGGTGCGTTATTTAAAAAATTTTCTCTGGGGGGCGCGCCGCGTTTTT


Protein sequences

Name Description Sequence
Ghi.336 translated coding region predicted by ESTScan from UniGene Ghi.336

XARDLVFVGGEVEGYSLEQLMRASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMMEDRASFGHS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF779
15-292 SUBFAMILY NOT NAMED

YSLEQLMRASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMMEDRAS

HMMPanther: PTHR24420
15-292 FAMILY NOT NAMED,FAMILY NOT NAMED

YSLEQLMRASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMMEDRAS

ProfileScan: PS50011
IPR000719
22-296 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMMEDRASFGHS

HMMSmart: SM00219
IPR020635
22-278 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMI

HMMSmart: SM00220
IPR002290
22-287 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMM

superfamily: SSF56112
IPR011009
26-287 Protein kinase-like (PK-like)
Protein kinase-like domain

ELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMM

HMMPfam: PF00069
IPR017442
26-276 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDYQPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALK

Gene3D: G3DSA:3.30.200.20
26-99 no description

ELLGRGTMATTYKAVVDRQLILTVKRLDAGRTAVTGGEAFEQHMEAVGGLVHPNLVPLRAYFQAKGERLVIYDY

Gene3D: G3DSA:1.10.510.10
100-287 no description

QPNGSVFNLVHGSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSTNVLLGTDFEACLTDYCLAVLADSSSTEDPDSLAYKAPEIRKSNRKLTPKSDVYAFGVFLLELLTGKHPSQHPVLVPHDLLEWVRTIREDDVGEYRWLXMLTEVASVCSLTSPEQRPAMWQALKMIQEIKESAMM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox