PRGDB00068332 (Ghi.1244)

From PRG Wiki
Jump to: navigation, search
Ghi.1244
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78352400 (DT572674)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

EST1083314 TMO Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

CTTTTATCCTACGCACCACTCGATTCTCTTAAGGTGCGCACCTTTCGCCGGCGTCGTCGTTTCGGATCTCCTGCTCAAGTAATACCGACAGTCGGCGACCAAATTTTAGGAGACATAACATTTTATACTAAATTAGCAACAATTCTCAAGGGATTGAACCATGAGTTGTTTTGGCTGTTGTGAAGAGGACAATATCCACAAAACCACTGATAATGGAGGCCAACACATGGTTAAAATTTCAGCAGGAAGCGATGGAGTTTACCATTCATCTGAAACTGCATCAAAGAGTGCTCAAACTTTGAAGGTTCAGCCTATTGAAGTCCCTGATATTCCGGTAGATGAATTGAAAGAAGTCACAGATAATTTTGGTGCAAATTCTTTGATTGGAGAAGGCTCATATGGTAGAGTCTACTATGGAGTTCTTAAAAGTAGGCAGGCTGCAGCAATCAAAAAGTTAGATGCCAGCAAGCAACCTGATGATGAGTTTTTAGCCCAGGTTTCCCTGGCATCTAGGTTGAAGCATGAAAACTTTGTTCAATTGCTTGGTTACTGTGTTGATGGGAGCTACCGTATTCTTGCTTATGAATTTGCATCTAATGGATCGTTGCATGATATTCTCCACGGGAGAAAAGGTGTTAAGGGATCTCAGCCAGGTCCTGTTTTGACATGGGCACAAAGAGTAAAAATTGCTGTAGGAGCTGCAAAAGGGCTTGAGTACTTACATGAGAAGGCTGATCCTCACATCATTCATCGTGACATTAAGTCCAGCAATGTGCTAATATTTGATGACGATGTTGCTAAGATTGCAGACTTTGATTTATCTAATCAGGCTCCTGATATGGCAGCTCGTCTTCATTCCACTCGTGTACTTG


Protein sequences

Name Description Sequence
Ghi.1244 translated coding region predicted by ESTScan from UniGene Ghi.1244

MSCFGCCEEDNIHKTTDNGGQHMVKISAGSDGVYHSSETASKSAQTLKVQPIEVPDIPVDELKEVTDNFGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
45-237 SUBFAMILY NOT NAMED

QTLKVQPIEVPDIPVDELKEVTDNFGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVL

HMMPanther: PTHR24420
45-237 FAMILY NOT NAMED,FAMILY NOT NAMED

QTLKVQPIEVPDIPVDELKEVTDNFGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVL

Gene3D: G3DSA:3.30.200.20
54-129 no description

VPDIPVDELKEVTDNFGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLG

superfamily: SSF56112
IPR011009
55-235 Protein kinase-like (PK-like)
Protein kinase-like domain

PDIPVDELKEVTDNFGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTR

ProfileScan: PS50011
IPR000719
69-238 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLX

HMMSmart: SM00220
IPR002290
69-238 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLX

HMMSmart: SM00219
IPR020635
69-237 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGANSLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVL

HMMPfam: PF07714
IPR001245
73-224 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGEGSYGRVYYGVLKSRQAAAIKKLDASKQPDDEFLAQVSLASRLKHENFVQLLGYCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQA

PatternScan: PS00107
IPR017441
75-98 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYGVLKSRQAAAIKK

Gene3D: G3DSA:1.10.510.10
130-227 no description

YCVDGSYRILAYEFASNGSLHDILHGRKGVKGSQPGPVLTWAQRVKIAVGAAKGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDM

PatternScan: PS00108
IPR008271
195-207 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox