PRGDB00068335 (Ghi.1467)

From PRG Wiki
Jump to: navigation, search
Ghi.1467
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84166784 (DR455432)
Gene Class Unknown
Domain Type
Gene Species Gossypium hirsutum

Comment?

CM034B11 Cotton Lambda Zap Express Library Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

CAACTCTTCTCTTCATCCTTTTCATTGGAAGCTTCTCTTCCAAAGAGTGATCAGTGATATTTGTTGGAGGGAGAAAAGATGGACTATGTGTACGGACCAGGAAAGAACCATCTCTTTGTTCCAGTGCCGGTTAACATCCCGGAACCAGTTCTTCGAGCCATGAACAGGAACAATGAGGATTACCGTTCCCCTGCCATTCCTGCCATGACAAAAAATCTTCTTGAAGATGTCAAGAAAATTTTCAAGACTAGTACTGGAACTCCCTTTTTGATTCCAACTACAGATCATTATAGGCACCCAGCATTACTTCTTGTTGATGGAGTTTCCTCTATTTGTGCCCTTGATTTTCGTATGGATGAGTGGGGAGTAGACGTCGCACTAACCGGTTCTCAGAAGGCACTTTCTCTTCCCACAGGACTGGGTATTGTTTGTGCAAGCCCCAAAGCTTTGGAGGCATCCAAAAGTGCAAAATCAGTTAGAGTTTTCTTTGACTGGAATGACTACCTCAAGTTCTACAAACTGTGAACATTTTGGCCATACACCCCTTCAATCCAGCTATTGTATGGGCTAAGAGCCGCTCTTGATCTTATATTCGAAGAAGGATCGGGAATGTGATTGAAGGCATACCGTATGGGaaaaaaaaaGGTTGTGTGTGGCATGGGTTTAAAAATGACACAAAGGGGGATGGGCCTGACCTTGCTTGTTCCTTGTCCCTTATTTGATATGCGAATAGTAAGGGCTGCAAGTA


Protein sequences

Name Description Sequence
Ghi.1467 translated coding region predicted by ESTScan from UniGene Ghi.1467

MDYVYGPGKNHLFVPVPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKL

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
7-68 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGKNHLFVPVPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTT

HMMPfam: PF00266
IPR000192
57-130 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

TSTGTPFLIPTTDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSA

HMMPanther: PTHR21152:SF7
68-147 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK

HMMPanther: PTHR21152
68-147 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

TDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK

superfamily: SSF53383
IPR015424
71-145 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKF

Gene3D: G3DSA:3.40.640.10
IPR015421
72-146 no description
Pyridoxal phosphate-dependent transferase, major r

RHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFY

PatternScan: PS00595
IPR020578
97-117 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox