PRGDB00068418 (Ghi.6818)

From PRG Wiki
Jump to: navigation, search
Ghi.6818
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 109853316 (DW482295)
Gene Class Unknown
Domain Type
Gene Species Gossypium hirsutum

Comment?

GH_RMIRS_035_F02_R Cotton Normalized Library random primed Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

ATCAGGCAGAGGACGAGACAATGCCCCCTATTGTCTCGTTCTGCGATGGGGATGTTATTTTGCAGATAAGCAGATGCAGCAGCAACTCCACTTCCAAGCTTAACTGGGTATCCAACATCTTTCAGTATCATCTCCACACCAGCTAAACAACCCAGCAGTTGCAACTCGTTTAGGTTTCCAAGATGTCCTATTCTGAAAACTTTTCCTGCCACTTTGTTAAGGCCAAGACCTAAGCTCAAATTGTATCTCTTCCATGCCCGTTTAATGATTTCCGAACTATCAATATATGGTGGAACAAGCACCGCCGTCACCGTGTCACTGAACCATTCCTCCTTTTGTGTGCAATTCTTCAAGCCCCAAGCTTCCACTGCAAGCCTTGTTGCTTTGCCTAAACGACTATGCCTTTCAATGACATTGTCAAGTCCTTCCTCAAAAATAAGGTCCAAAGCTGCTCTTAGTCCATACAAGAGTTGAATTGAAGGAGTGTAAGGCCAAAATGTTCCTAATTTGTAAAACTTAAGGTAATCGTTCCAATCGAAGAAAACCCGGACTGATTTCGCGGTTTTGGTCGCCTCGAGAGCTTTCGGGCTAGCGCAAACAATACCGATCCCGGTTGGAAGAGAAAGCGCCTTTTGCGAGCCGGTTAAGGCTACGTCAACTCCCCATTCATCCATACGGAAATCGAGGGCACAAATCGAGGAAACTCCATCGACGAGAAGCAGTGCTGGGTGCCCGTAATGATCT


Protein sequences

Name Description Sequence
Ghi.6818 translated coding region predicted by ESTScan from UniGene Ghi.6818

XDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIIKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPIAERDNRGHCLVLCLX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
2-242 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIIKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPIAERDNRGH

HMMPanther: PTHR21152
2-242 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

DHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIIKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPIAERDNRGH

superfamily: SSF53383
IPR015424
4-215 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

YGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIIKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

Gene3D: G3DSA:3.40.640.10
IPR015421
6-96 no description
Pyridoxal phosphate-dependent transferase, major r

HPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYG

HMMPfam: PF00266
IPR000192
7-161 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

PALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEII

PatternScan: PS00595
IPR020578
30-50 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
97-221 no description
Pyridoxal phosphate-dependent transferase, major r

LRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIIKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox