PRGDB00068419 (Ghi.6858)

From PRG Wiki
Jump to: navigation, search
Ghi.6858
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31072574 (CA992853)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

pAR03-2 pAR Gossypium hirsutum cDNA 5', mRNA sequence

DNA Sequence

tttttttttttttttttttAAGAAATTATGTAATTGATGCATCCAAGGAAAATGGCTATTATTTGTTGTACAATTCTGAAATGCCAACCATTCCTAGATTATCACATTACAGTCCTCTATTATATTATGAAGAAAAATTGAAACTGGTTGTATATATTTACATATTATTAACAATGATGATAATACCAATAAGTTCACTTGTTGCCTATCACTGTCAACGGGGTGCAATGGAAGGAATTACACCACTAACAAGATCACTCCCTGTCACATTCAATGACGAAGCATATACCTCCCTGCTAGTGCCACCGTACGACGAGGACGATGTCAATGACTTGCCTGAATATAATTGAACCAACTCGGTTGATGAAGAAACCGAATCAGTTTCCGGCATCATTTTGAGTACGTATTCTAGTTGTCTCACCACATCCAACATAGACGGTCGCTTCTCTGGCTCGTCATTGCAGCAACTCAGGGCTAAACTTACCATTCTCTCCATACATTCAGCTGGATACCAACCCATTCTACTGTCTATTAAAGACAATACCATGCCCGATTCATGTGCTGTTTTCACCTCTCGGACAATGTTTTTGCCATGCCATATTGGATGCATACCCGTCAACAGTTCCAAGAAAACAACTCCAAGGCTATAAACATCACTTTTATCAGTCAACTTATGTGTCAAAAAGTATTCTGGATCAAGGTAACCCGGTGTTCCCTTCACAACCGTGGAAACATGATCCGGCACAGTCCCTTCTTCTTCCAGGACTGGAGCTAACCGTGAGAGACCAAAATCAGAAACTTTTGCATTAAGGTTGGAGTCCAGAAGAATGTTGGTGGCTTTGATATCTCGGTGGAATACTGGAGGATTTGCTTCAGTATGGAGATAAAGAATTCCTCTCGCTGAACCCAGTGCAATACGTAATCTCATTCCAAAATTCAGGGTGTTTTTAGCTTTAGCAGAAAGCCAGTCCCTCAAGGTGCCATTGGGCATGAACTCGTACACCAACATCTGTTCCCCTTCTTCATCACAGTATCCAACGAGTGAAACCAGATTTCGGTGATGCAGCCTTGACAAAAGCTTTATCTCTGTCAAAAATTCTTTTTGTCCTTGCAATGATCCTTCTTCTGCACGTTTTATGGCAACAAC


Protein sequences

Name Description Sequence
Ghi.6858 translated coding region predicted by ESTScan from UniGene Ghi.6858

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYVLKMMPETDSVSSSTELVQLYSGKSLTSSSSYGGTSREVYASSLNVTGSDLVSGVIPSIAPR

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-269 Protein kinase-like (PK-like)
Protein kinase-like domain

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYVLKMMPETDSVSSSTELVQLY

ProfileScan: PS50011
IPR000719
1-249 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYV

HMMPanther: PTHR24420:SF772
1-310 SUBFAMILY NOT NAMED

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYVLKMMPETDSVSSSTELVQLYSGKSLTSSSSYGGTSREVYASSLNVTGSDLVSGVIPSIAPR

HMMPanther: PTHR24420
1-310 FAMILY NOT NAMED,FAMILY NOT NAMED

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYVLKMMPETDSVSSSTELVQLYSGKSLTSSSSYGGTSREVYASSLNVTGSDLVSGVIPSIAPR

HMMSmart: SM00220
IPR002290
1-249 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VVAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYV

HMMPfam: PF07714
IPR001245
2-246 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQL

Gene3D: G3DSA:3.30.200.20
2-55 no description

VAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPN

HMMSmart: SM00219
IPR020635
2-246 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VAIKRAEEGSLQGQKEFLTEIKLLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQL

Gene3D: G3DSA:1.10.510.10
56-268 no description

GTLRDWLSAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGLSRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPEKRPSMLDVVRQLEYVLKMMPETDSVSSSTELVQL

PatternScan: PS00108
IPR008271
97-109 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDIKATNILL

Seg: seg
268-284 seg

LYSGKSLTSSSSYGGTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox