PRGDB00068426 (Ghi.7841)

From PRG Wiki
Jump to: navigation, search
Ghi.7841
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164324908 (ES806525)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_645_35 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGGTTTTCGGGTCCAATCCCAGCTGAGATTGGAAAGTTGCAGCAACTTTCAAAGATTGATTTCAGTCATAACAAGTTTTCAGGATTGATCCCACCAGAAATTTGCAAATGCAAGCTGTTAACCTTTGTTGATCTTAGTGGAAACGAGCTTTCAGGTCGAATTCCGACTGAGATCACAAGTATGAGGATATTAAACTACCTGAATCTGTCGAGAAATCATCTCCTGGGTAGCATCCCTTCTTCAATATCCACTATGCAAAGCTTAACTTCAGTCGATTTCTCTTATAACAATCTCTCCGGTTTGGTTCCTGGCAGTGGTCAGTTTAGTTACTTCAACTACACCTCATTTTTGGGGAACCCTGAGCTGTGTGGTCCTTATTTGGGGCCTTGCAAAGATGGGGTTGCTAAAGGAACTCATGAAACTCATATTAAAGGTGGACTCTCTGCATCTTTGAAACTTTTGCTCGTTATAGGCCTGCTTGTCTTCTCCATCTTGTTTGCAGTTGTGGCTATAATCAAAGCACGGTCCTTGAAGAAAGCGAGTGATTCTCGGGCTTGGAAGTTAACCGCGTTCCAGCGCTTGGATTTTACTTGTGATGATGTTTTGGATTGTTTGAAGGAGGATAATATTATAGGCAAAGGAGGTGCTGGGATTGTGTACAAGGGATCCATGCCTAGTGGTGACCATGTTGCCGTTAAAAGGTTACCGGCAATGAGCCGAGGGTCTTCCCATGATCACGGATTCAATGCTGAGATACAAACTCTGGNGAGGATTAGGCACAGGCATATTGTGAGATTGTTGGGGTTTTTGCTCAAACCATGAAACCAATCTCTGGNTTTATGAGTATATGCCTAAATGGGAGTTTAGGGAGAGGTTCCTTCATGGCAAAGAAAGGGGGGTCATTTGGCACTGGGGATACCAGATNACAAAGATTCGCTGTTAGAGGGCTGCCTAAAGGAACTATGGCTAACCTTTCATCCATGAATTGTTCCCCCTTTTGAATAATTCCACCGGGGAACGTGAAAAATCGAAACAATAATTTCTTCCCTCCAACTCCAAAATTTTTGGAAAACCTCCCCGGTTTGCTGTGATTTTTCGGGCCCTTTGGCTAAAATTTTCCCGGCCAAAGAAATTCCAAGGGACCCTTTCCCGGGAAAATGTCCAGTGGTcccccccccAATAAACCCCGCGGGTTTCCAATACACGAGAAAAAAACTTTTTTGGCCCTCCCCCaaaaaaaaatttgccctccttacacccccccgtgaaaaaagggggaaaaagaacaaaaaagaaaaagaaaagaaaGAGGGGAGAGGGTGTGGTTTTTATTTAAAGATCTCTTTT


Protein sequences

Name Description Sequence
Ghi.7841 translated coding region predicted by ESTScan from UniGene Ghi.7841

GTRFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGSGQFSYFNYTSFLGNPELCGPYLGPCKDGVAKGTHETHIKGGLSASLKLLLVIGLLVFSILFAVVAIIKARSLKKASDSRAWKLTAFQRLDFTCDDVLDCLKEDNIIGKGGAGIVYKGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRIXAQAYCEIVGVFAQTMKPISGFMSICLNGSLGRGSFMAKKGGSFGTGDTRXQRFAVRGLPKGTMANLSSMNCSPF

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-133 L domain-like,LRR

GTRFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGSGQFSYFNYTSFLGNPELCGPYLGPCK

Gene3D: G3DSA:3.80.10.10
2-128 no description

TRFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGSGQFSYFNYTSFLGNPELCGPY

HMMPanther: PTHR24420:SF462
3-260 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGSGQFSYFNYTSFLGNPELCGPYLGPCKDGVAKGTHETHIKGGLSASLKLLLVIGLLVFSILFAVVAIIKARSLKKASDSRAWKLTAFQRLDFTCDDVLDCLKEDNIIGKGGAGIVYKGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRI

HMMPanther: PTHR24420
3-260 FAMILY NOT NAMED,FAMILY NOT NAMED

RFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGSGQFSYFNYTSFLGNPELCGPYLGPCKDGVAKGTHETHIKGGLSASLKLLLVIGLLVFSILFAVVAIIKARSLKKASDSRAWKLTAFQRLDFTCDDVLDCLKEDNIIGKGGAGIVYKGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRI

HMMPfam: PF13855
42-100 LRR_8,Leucine rich repeat

LTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNL

Seg: seg
145-168 seg

IKGGLSASLKLLLVIGLLVFSILF

Gene3D: G3DSA:2.60.120.200
IPR013320
165-222 no description
Concanavalin A-like lectin/glucanase, subgroup

SILFAVVAIIKARSLKKASDSRAWKLTAFQRLDFTCDDVLDCLKEDNIIGKGGAGIVY

superfamily: SSF56112
IPR011009
179-291 Protein kinase-like (PK-like)
Protein kinase-like domain

LKKASDSRAWKLTAFQRLDFTCDDVLDCLKEDNIIGKGGAGIVYKGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRIXAQAYCEIVGVFAQTMKPISGFMSICLNGSL

HMMPfam: PF00069
IPR017442
209-291 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EDNIIGKGGAGIVYKGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRIXAQAYCEIVGVFAQTMKPISGFMSICLNGSL

Gene3D: G3DSA:3.30.200.20
223-275 no description

KGSMPSGDHVAVKRLPAMSRGSSHDHGFNAEIQTLXRIXAQAYCEIVGVFAQT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox