PRGDB00068428 (Ghi.7959)

From PRG Wiki
Jump to: navigation, search
Ghi.7959
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164329148 (ES808947)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_196_73 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGAGGTGACGACAGAAGAGGGTTGTGGAATTGGGAAGCCGAAGAAGAAGCTACTGCGATTGCGATTGCCAACTCATTCTTCCGTCATGGGCAACTGTGGCACTAGAGAGGAATCTGACGTTGTTACTCATGCTCAAGTTCAACAGCTCCACAACCACATCGTATCCGACAAGAAGCTTACTCAAAGTCAGAGCCAGACTCAGAATCGTACCCTCTCAGATCTGAGCGACTTCGAGGATTCCAGGAAAAATGCGCTTCTCTATACCCACATCATTGCCTTCACTTTATTCGAGCTTGAGACTATTACCAAGAGCTTCCGTTCTGACTATATTCTCGGGGAAGGTGGCTTCGGAACCGTCTATAAAGGTTACATTGACGAGAATGTGCGGGTCGGTCTCAAATCTCTGCCTGTCGCTGTCAAGGTCCTCAACAAGGAGGGCCTTCAGGGTCACCGCGAATGGCTTACTGAGGTCAACTTCCTCGGCCAGCTCAGGCATCCCAATCTGGTAAAGCTGATCGGTTATTGTTGTGAGGATGATCACAGGCTACTTGTATACGAATTCATGTTCCGTGGTAGTCTTGAGAACCACCTTTTTCGAAAGGCAACTGTACCTTTATCCTGGGCGAAAAGAATGATGATTGCTCTAGGAGCTGCTAAAGGGCTTGCTTTCCTACACAATGCTGAAAGACCCGTAATATATAGGGATTTTAAAACCTCCAATATATTGTTGGACTCTGATTATACAGCCAAGCTTTCTGATTTTGGACTTGCAAAAGCTGGGACCACAAGGTGATGAGACTCACGTATCAACTCGAGTGATGGGAACATATGGATATGCTGCACCTGAATATGTTATGACTGGTCATCTGACTGCGAGGAGTGATGTATACAGCTTCGGAGTTTGTTCTTTGGGAGCTTTTGACGGGAAGAAAATCTGTTGATAAGACAGAACAAAGCAGGAGCAGAATTTGGTGGATTGGGCTCGGccaaaactgaatgatagaaaaaaattactcaaataaatggaccaaaaatggaaaaaCCAGTATTCACCAAGGGCTGCCCCAAAAGGATGGAACTTTGGGAAAACTAATGGTTTTAACCCAAAATCCAAAAAACAAGGGGCCTTAAAGGGAAGGGAATTTTGGGTAAAAACCCTGGGAACCCCTTCAAAAAGGGCCCgggggggggtggggggcaaaaaaaaaaaatttcccccctcctctctttttttaaaaatccataaaaaaa


Protein sequences

Name Description Sequence
Ghi.7959 translated coding region predicted by ESTScan from UniGene Ghi.7959

XAREVTTEEGCGIGKPKKKLLRLRLPTHSSVMGNCGTREESDVVTHAQVQQLHNHIVSDKKLTQSQSQTQNRTLSDLSDFEDSRKNALLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCSLGAFDGKKIC

Domains

Domain Start-End Description Sequence

Seg: seg
15-26 seg

KPKKKLLRLRLP

superfamily: SSF56112
IPR011009
80-304 Protein kinase-like (PK-like)
Protein kinase-like domain

FEDSRKNALLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVC

Gene3D: G3DSA:3.30.200.20
93-177 no description

IIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGY

HMMPanther: PTHR24420:SF861
93-303 SUBFAMILY NOT NAMED

IIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGV

HMMPanther: PTHR24420
93-303 FAMILY NOT NAMED,FAMILY NOT NAMED

IIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGV

ProfileScan: PS50011
IPR000719
108-315 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCSLGAFDGKKIC

HMMSmart: SM00220
IPR002290
108-314 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCSLGAFDGKKI

HMMSmart: SM00219
IPR020635
108-314 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCSLGAFDGKKI

HMMPfam: PF07714
IPR001245
113-305 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCS

PatternScan: PS00107
IPR017441
114-143 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGTVYKGYIDENVRVGLKSLPVAVK

Gene3D: G3DSA:1.10.510.10
178-306 no description

CCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWAKRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVCSL

PatternScan: PS00108
IPR008271
234-246 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox