PRGDB00068430 (Ghi.8140)

From PRG Wiki
Jump to: navigation, search
Ghi.8140
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31324527 (AF487461)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

Gossypium hirsutum receptor kinase Lecrk mRNA, complete cds

DNA Sequence

gcacgagctcgtgccgaattcggcacgaggAGAGCTTCTTTGAAATTTCAAACTAATCTAAAGCTGTGTTATATGTCGGAGACATAAAATGAAAGAAGAACAGAATATAAAGACGACAGTGTTAGTAGACATTGGCCATGTGTTTCAGATTCTCGAATCTGCTGACTCTACTTCTGATTAGCTTTGCAGCTGCCGAGGATGTTGGTTTCATCTACAACGGATTCCGGTCGGCTAATCTAAACCTTGATGGCATTGCAGAACTCACTTCCAATGGACTCCTAAAGCTCACCAATAAAACCGTGCAAGAAACAGGTCATGCTTTCTACCCTCACCCCGTTGATTTCAAGAACTCTACCAACGGTTCTGTTTTTTCCTTCTCTTCCACCTTTGTCTTCGCCATACTTCCGGAGTATCCAACTCTCAGCGGCCATGGAATCGCTTTCGTGATTGCACCAACCAAAGGCCTCCCCGGATCTCTTCCAAGTCAGTATCTCGGACTGTTCAATGGGTCCAACAATGGCAATGATACAAACCATGTTGTTGCTGTAGAACTCGACACCATACGAAGTACGGAGTTCGATGATATCAATGACAATCACGTTGGGATTGACATTAATGGGTTGAAGTCTCCTACTTCTTCTCCAGCTGGATATTATGAGGACGACAGCCATGACTTTAAAAACCTGACCTTGATCAGTGGTAAGCAGATGCAAGTTTGGGTCGAATATCATGGTCTAGAAAAGAGAATGGATGTCACTTTAGCTCCATTTAAGGTTCCTAAGCCCGACACCCCACTTTTATCCTTGTCTCGTGATCTGTCTTCAATTGTTAACCGTGAGAATGTATGTTGGTTTTTCATCGTCAACTGGTTCGGTCCTCACATCTCATTATGTTTTGGGCTGGAGCTTTCAAGGTTAATGGTCCAGGCAGAAGAGCTTACCCTGTCTCAACTTCCCAAGCTTCCTCGGTTAGGACCAAAGAAAAAGCCGAAAGTTTTGACAATTGGGTTGCCTTTGATTTTGGTGAGCTTGGCTTTGGCAGGAGTTTCCGGTGCTGCTTACTTGGTAAGGAGGAAAAGGAAGTTTGCTGATGTAGTTGAAGATTGGGAGCTTGAGTATGGGCCTCATAGATTCAAGTTTAAAGATCTATATATTGCTACAAAAGGATTCAAAGACAAGGAATTATTGGGTGCTGGTGGATTTGGAAGGGTCTACAGAGGAGTTCTTCCAAGCAATAAACTTGAGGTTGCAGTGAAAAGAGTCTCGCATGAATCAAGGCAAGGGATGAGGGAATTTGTAGCAGAAATTGTGAGTATTGGTCGTCTTCGACACCGGAATTTAGTCCAACTCTTGGGATATTGCCGGCGCAAAGATGAGCTGCTTTTGGTCTATGACTACATGCCTAATGGAAGTCTTGATAAGTATTTGCATGACCAGCCAAAAGTCACCCTAAATTGGAGACAAAGATTCAGAGTCATCAAAGGTGTAGCATCAGGATTGTTCTATTTACATGGAGAATGGGATCAAGTTGTGGTTCATAGAAATGTTAAAGCCAGCAATGTTTTACTGGATGGCGAATTAAATGGAAGATTGGGAGATTTTGGGCTTGCTAGATTATATGACCATGGAACGGATCCCCAAACAACTCACGTTGTGGGAACTCTTGGTTATTTGGCTCCCGAGCATACTCGAACCGGGAAAGCCACGCCGTCCACCGATGTGTTTGCTTTCGGGGCATTTTTGCTTGAAGTTGCGTGTGGAAGAAGGCCAATAGAGGCAAAATCTCCGACAGAAGATGTAATCTTGGTAGATTGGGTGTATTCATGTTGGTCCAACGGTGATATTATGGAGGCCAAAGATCCGAATCTGGGTTCAGGTTATGAGGCAGAGGAAGTTGAGTTGGTTTTAAAACTTGGGTTGCTCTGCTCTCACTCAGAACCTGAAGCAAGGCCAACCATGCGGCAAAGTCCTTCAGTTTTTAGAAGGGGATCTTCCATTTCCAGAAATGTCATCACTCAGTCTCACTTCCAGTGGACTAACATTTGGACATCGACAAGGGTTTGATGATTATGTCATGTCGTATTCATCTTCCGTTTGCAAGGGATTCTCCCATTGTTCTGTTGCAGATTCTTTACTTTCTGGAGGTCGATGATTGTAAAATTTTTCTCAGTGTTAATAAGTTGTAATCCATTACTTTGCATAAAAGCTTACTTATTTGAATaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ghi.8140 translated coding region predicted by ESTScan from UniGene Ghi.8140

MCFRFSNLLTLLLISFAAAEDVGFIYNGFRSANLNLDGIAELTSNGLLKLTNKTVQETGHAFYPHPVDFKNSTNGSVFSFSSTFVFAILPEYPTLSGHGIAFVIAPTKGLPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRENVCWFFIVNWFGPHISLCFGLELSRLMVQAEELTLSQLPKLPRLGPKKKPKVLTIGLPLILVSLALAGVSGAAYLVRRKRKFADVVEDWELEYGPHRFKFKDLYIATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFLEGDLPFPEMSSLSLTSSGLTFGHRQGFDDYVMSYSSSVCKGFSHCSVADSLLSGGR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:2.60.120.200
IPR013320
20-234 no description
Concanavalin A-like lectin/glucanase, subgroup

EDVGFIYNGFRSANLNLDGIAELTSNGLLKLTNKTVQETGHAFYPHPVDFKNSTNGSVFSFSSTFVFAILPEYPTLSGHGIAFVIAPTKGLPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRE

superfamily: SSF49899
IPR008985
21-234 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

DVGFIYNGFRSANLNLDGIAELTSNGLLKLTNKTVQETGHAFYPHPVDFKNSTNGSVFSFSSTFVFAILPEYPTLSGHGIAFVIAPTKGLPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRE

HMMPfam: PF00139
IPR001220
21-234 Lectin_legB
Legume lectin, beta chain

DVGFIYNGFRSANLNLDGIAELTSNGLLKLTNKTVQETGHAFYPHPVDFKNSTNGSVFSFSSTFVFAILPEYPTLSGHGIAFVIAPTKGLPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRE

Seg: seg
71-86 seg

NSTNGSVFSFSSTFVF

HMMPanther: PTHR24420:SF435
110-650 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRENVCWFFIVNWFGPHISLCFGLELSRLMVQAEELTLSQLPKLPRLGPKKKPKVLTIGLPLILVSLALAGVSGAAYLVRRKRKFADVVEDWELEYGPHRFKFKDLYIATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFLEGDLPFPEMSSLSLTSSGLTFGHRQGFDDYVMSYSS

HMMPanther: PTHR24420
110-650 FAMILY NOT NAMED,FAMILY NOT NAMED

LPGSLPSQYLGLFNGSNNGNDTNHVVAVELDTIRSTEFDDINDNHVGIDINGLKSPTSSPAGYYEDDSHDFKNLTLISGKQMQVWVEYHGLEKRMDVTLAPFKVPKPDTPLLSLSRDLSSIVNRENVCWFFIVNWFGPHISLCFGLELSRLMVQAEELTLSQLPKLPRLGPKKKPKVLTIGLPLILVSLALAGVSGAAYLVRRKRKFADVVEDWELEYGPHRFKFKDLYIATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFLEGDLPFPEMSSLSLTSSGLTFGHRQGFDDYVMSYSS

PatternScan: PS00307
IPR019825
135-141 LECTIN_LEGUME_BETA
Legume lectin, beta chain, Mn/Ca-binding site

VAVELDT

Seg: seg
272-287 seg

LPKLPRLGPKKKPKVL

superfamily: SSF56112
IPR011009
314-622 Protein kinase-like (PK-like)
Protein kinase-like domain

RKFADVVEDWELEYGPHRFKFKDLYIATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFLEGDLPFPE

Gene3D: G3DSA:3.30.200.20
324-408 no description

ELEYGPHRFKFKDLYIATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYC

ProfileScan: PS50011
IPR000719
344-670 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFLEGDLPFPEMSSLSLTSSGLTFGHRQGFDDYVMSYSSSVCKGFSHCSVADSLLSGGR

HMMSmart: SM00220
IPR002290
344-614 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNLKQGQPCGKVLQFL

HMMSmart: SM00219
IPR020635
344-601 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPNLGSGYEAEEVELVLKLGCSALTQNL

HMMPfam: PF00069
IPR017442
345-551 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPT

PatternScan: PS00107
IPR017441
350-373 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGGFGRVYRGVLPSNKLEVAVK

Gene3D: G3DSA:1.10.510.10
409-552 no description

RRKDELLLVYDYMPNGSLDKYLHDQPKVTLNWRQRFRVIKGVASGLFYLHGEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHTRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTE

Seg: seg
624-634 seg

SSLSLTSSGLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox