PRGDB00068431 (Ghi.8145)

From PRG Wiki
Jump to: navigation, search
Ghi.8145
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 28916445 (AY212968)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

Gossypium hirsutum ser-thr protein kinase mRNA, partial cds

DNA Sequence

GTGGTTTCTGTCAAACCTTGGGCCACGGGATTAAGTGGGCAGCTGCAGAAGGCATTTGTAACAGGTGTACCGAAGCTCAAGCGATCAGAACTTGAAGCAGCTTGTGAGGATTTCAGCAATGTAATTGGTACCTTTTCTGATGGAACAGTCTACAAGGGGACTTTATCAAGTGGGGTCGAAATAGCAGTGACATCAACTGCGATTTCGTCTCGTGAAGACTGGTCAAAGAATTTAGAGACACAATTTAGAAACAAGATAGACTCGTTGTCTAAAGTGAACCACAAGAATTTCGTGAACCTCATTGGCTATTGTGAAGAAAATACGCCTTTCACAAGAATGATGGTTTTTGAGTATGTTCCTAATGGATCACTCTATGAGCATCTACATATACAAGAAGCTGAGCACTTGGACTGGGGAATGCGCCTAAGGATAGCCATGGGAATAACGTACTGCCTTGAGCATATGCATCAGCTTACTCCCCCTATAGCCCATAGAAACTTGCAGTCTTGCTCTGTATATCTGACTGAAGACTATGCTGCAAAAATATCTGATTTCAGCTTCTTGAATAATGCTACCGCAGCCAAGGTGGGATCGGCTACCATGGAGCTCTTAGAATCTCCATCAGCAGATGCAGAGAGCAATGTTTACAGCTTCGGGGTAATATTGTTTGAAATGATAACTGGTAGGATCCCGTATTCGATAGACAATAGCTCACTTGCAGACTGGGCCTCAGACTACTTGAAAAGGGACCAACCCTTGAAAGAAATGGTGGATCCAACTCTTAAATTTTTCCAAGGAGATGATCTGGAAAAATTGTTTGAAGTGGTTAAAACTTGTGTTAATCCTGATCCAAAAGAGAGACCAACAATGAGAGAAGTTGCAGCCAAGTTAAAAGAGATTACAGCAATGGGACCTGATGGAGCAACTCCAAAACTCTCTCCCCTTTGGTGGGCTGAGCTTGAAATATTGTCTACAGAACCAAGTTAATCAGTGAAATTGAAATTTAACGCTAATAAATTTGCATTCTGTTTTCCCTGTTTCTATTGTTGGGCTCCGAAGCAGCGCAGTTCCAAGTAGATTCTGCTTCTTTAATCAAAAGCTTGGAAAGAGAAATGAATCTTTGTATATAATTCATAGAGAAAAATATTTGATGTGAGccttgatttgctgctgcttctccattctttgcttgcttttgtttcctttccttttccTCATTTGTTCATTCTGATTCTAAAGTGGATGGTATAAATTCCAGTAGAGCAACTTGGGaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ghi.8145 translated coding region predicted by ESTScan from UniGene Ghi.8145

VVSVKPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKLKEITAMGPDGATPKLSPLWWAELEILSTEPS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF458
3-326 PTHR24420:SF458,SUBFAMILY NOT NAMED

SVKPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKLKEITAMGPDGATPKLSPLWWAELEILSTE

HMMPanther: PTHR24420
3-326 PTHR24420,FAMILY NOT NAMED

SVKPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKLKEITAMGPDGATPKLSPLWWAELEILSTE

Gene3D: G3DSA:3.30.200.20
22-103 G3DSA:3.30.200.20

GVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGY

superfamily: SSF56112
IPR011009
27-326 Kinase_like
Protein kinase-like domain

KRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKLKEITAMGPDGATPKLSPLWWAELEILSTE

ProfileScan: PS50011
IPR000719
36-300 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKLKEI

HMMPfam: PF07714
IPR001245
39-297 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDWSKNLETQFRNKIDSLSKVNHKNFVNLIGYCEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAAKL

Gene3D: G3DSA:1.10.510.10
104-295 G3DSA:1.10.510.10

CEENTPFTRMMVFEYVPNGSLYEHLHIQEAEHLDWGMRLRIAMGITYCLEHMHQLTPPIAHRNLQSCSVYLTEDYAAKISDFSFLNNATAAKVGSATMELLESPSADAESNVYSFGVILFEMITGRIPYSIDNSSLADWASDYLKRDQPLKEMVDPTLKFFQGDDLEKLFEVVKTCVNPDPKERPTMREVAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox