PRGDB00068432 (Ghi.8282)

From PRG Wiki
Jump to: navigation, search
Ghi.8282
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78339836 (DT560110)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Gossypium hirsutum

Comment?

EST1070750 TMO Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

TCTCCACTTGGGACTTCACCGCACCAGATCCTTGCTCCTCATTCACCGGCGTCACCTGCGGTTTCAACGACCGAGTCACCATTCTGTCGCTCGGCACTGGCCTTTCCGACTCGCCTGGCCTCGCTGGCTCCCTCTCCCCTGCTCTTTCCAACCTTACCCAGCTAACCCAACTCATCCTCTTCCCTGGTCTCGTCACCGGTCCCATCCCTCCCCAACTGGGTCAACTCACTAGTTTTCGAGTCATTTCCTTGACCAACAACCGTTTAACAGGACCCATACCACCCTCCTTTTCTACTCTCCCCTTCTTGCACACTCTGGATCTGAGTTCAAACCGGCTCACCGGGTCCATCCCGCAAGGCCTCATGAAGCTTCCATCTTTAAAAGTTATGGTGTTGAGCTGGAACGAGTTAACAGGGGAGTTACCCAGAACAGTGTCGGCGCAGTTATTACACTTGGATTTGAAGAAGAACAAGATCAGCGGACCGTTGCCAAGGTTACCGTCAACTGTCCGTTACTTGTCAGTGTCGGAGAACTGGATGTGGGGCCCACTCAAGGCCCTGGAATCGCTATCCAAGTTAGTGTACCTGGACGTTAGCATGAACCAATTCAGTGGGCCCATCCCGGCTTCACTCTTCTTAAACCCCTCCCTCACTTCACTGTTTTTGCAACGGAACAATTTATCGGGTGGCCTCCCATCATCAATCAAGATGGACCCCACCTTCCAATCCTACGGCGGCCAGGGATCCATCGTGGACTTGAGCCATAACTTCATCACGGGGGATATAACCCCCTTCTTGGCTGGGGTGGAGACTCTCTTCTTGAACAATAACCATTTCACTGGGTCTGTACCTGAGAGTACGTGAAAAGCGTGTACGACGGCACCACCAAAACTTTGTATTTGCAGCATAACTATCTATCCAG


Protein sequences

Name Description Sequence
Ghi.8282 translated coding region predicted by ESTScan from UniGene Ghi.8282

XSTWDFTAPDPCSSFTGVTCGFNDRVTILSLGTGLSDSPGLAGSLSPALSNLTQLTQLILFPGLVTGPIPPQLGQLTSFRVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNELTGELPRTVSAQLLHLDLKKNKISGPLPRLPSTVRYLSVSENWMWGPLKALESLSKLVYLDVSMNQFSGPIPASLFLNPSLTSLFLQRNNLSGGLPSSIKMDPTFQSYGGQGSIVDLSHNFITGDITPFLAGVETLFLNNNHFTGSVPEST


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF511
2-285 LEUCINE-RICH REPEAT FAMILY PROTEIN

STWDFTAPDPCSSFTGVTCGFNDRVTILSLGTGLSDSPGLAGSLSPALSNLTQLTQLILFPGLVTGPIPPQLGQLTSFRVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNELTGELPRTVSAQLLHLDLKKNKISGPLPRLPSTVRYLSVSENWMWGPLKALESLSKLVYLDVSMNQFSGPIPASLFLNPSLTSLFLQRNNLSGGLPSSIKMDPTFQSYGGQGSIVDLSHNFITGDITPFLAGVETLFLNNNHFTGSVPE

HMMPanther: PTHR24420
2-285 FAMILY NOT NAMED,FAMILY NOT NAMED

STWDFTAPDPCSSFTGVTCGFNDRVTILSLGTGLSDSPGLAGSLSPALSNLTQLTQLILFPGLVTGPIPPQLGQLTSFRVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNELTGELPRTVSAQLLHLDLKKNKISGPLPRLPSTVRYLSVSENWMWGPLKALESLSKLVYLDVSMNQFSGPIPASLFLNPSLTSLFLQRNNLSGGLPSSIKMDPTFQSYGGQGSIVDLSHNFITGDITPFLAGVETLFLNNNHFTGSVPE

Gene3D: G3DSA:3.80.10.10
9-236 no description

PDPCSSFTGVTCGFNDRVTILSLGTGLSDSPGLAGSLSPALSNLTQLTQLILFPGLVTGPIPPQLGQLTSFRVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNELTGELPRTVSAQLLHLDLKKNKISGPLPRLPSTVRYLSVSENWMWGPLKALESLSKLVYLDVSMNQFSGPIPASLFLNPSLTSLFLQRNNLSGGLPSSIK

superfamily: SSF52058
18-284 L domain-like,LRR

VTCGFNDRVTILSLGTGLSDSPGLAGSLSPALSNLTQLTQLILFPGLVTGPIPPQLGQLTSFRVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNELTGELPRTVSAQLLHLDLKKNKISGPLPRLPSTVRYLSVSENWMWGPLKALESLSKLVYLDVSMNQFSGPIPASLFLNPSLTSLFLQRNNLSGGLPSSIKMDPTFQSYGGQGSIVDLSHNFITGDITPFLAGVETLFLNNNHFTGSVP

HMMPfam: PF13855
80-137 LRR_8,Leucine rich repeat

RVISLTNNRLTGPIPPSFSTLPFLHTLDLSSNRLTGSIPQGLMKLPSLKVMVLSWNEL

HMMPfam: PF00560
IPR001611
192-213 LRR_1
Leucine-rich repeat

KLVYLDVSMNQFSGPIPASLFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox